KEGG   Halioglobus japonicus: BST95_16725Help
Entry
BST95_16725       CDS       T04687                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
hja  Halioglobus japonicus
Pathway
hja00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BST95_16725
Enzymes [BR:hja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BST95_16725
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BST95_16725
    1.1.1.-  
     BST95_16725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DAO Pyr_redox_2 FAD_binding_3 Pyr_redox_3 AlaDh_PNT_C Shikimate_DH FAD_binding_2 Pyr_redox 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AQA19634
UniProt: A0A2N5YFX4
LinkDB All DBs
Position
complement(3557441..3558475)
Genome map
AA seq 344 aa AA seqDB search
MKAAVFEGVGKPLSIQDVPRPAAEPNELVVKVDYCGVCGTDLHATREGLTTAAEGQILGH
EYVGKIVEVGPEALGDWQVGDRVCSLPFIACGTCDACHAGRPYECQNKKVSGVDAQGAYA
EYVAAGGQETIKLPDDLDSQAAALIEPLAVGLHAVRMADVQPGSRVLVIGAGPIGLTVAL
WARFYGAASVVVSERADSRAALAQKMGATAVMRPAADTDAETLAAQYAELTGGAPEVIFE
CVGAPGLLQQCIEMAGHGGQIVPVGVCEQPDAIMPMLGLFKELRIQFAIAYTMDDFQTAM
SALAEQRIDVQPMITDIVTLDELPAAFEALRTPQDQCKVLIKID
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcggtatttgaaggtgtcggtaagccactgtcgattcaggacgtgccccgg
ccggcagccgaacccaatgagctggtggttaaggtcgattactgtggcgtttgcggcacc
gatctgcacgccacgcgagagggcctgactaccgccgctgaaggtcagattctcgggcac
gagtatgtcggtaagatcgtcgaggtgggcccagaggcgctcggtgactggcaggtgggt
gaccgtgtgtgttcactgccgttcatcgcctgcggcacttgtgacgcctgtcatgccggt
cggccctatgaatgccagaacaagaaagtatccggtgtggatgcacagggcgcctatgcg
gagtatgtcgcggccggcgggcaggaaaccatcaaactgcccgatgatctcgattcacag
gcagcggcactgattgagccgctggcggtgggactgcacgcagtgcgtatggccgatgtg
cagcccggaagtcgggtgctggttatcggtgcggggccaattggcctcaccgtggcgctg
tgggctcggttctacggcgcggcgagtgttgtcgtcagcgaaagggcggacagccgcgcg
gcactggcgcagaaaatgggtgccacggcggtcatgcggcccgcggcggataccgacgcg
gagacgttggcagcacagtacgctgaactgacgggcggcgcgcccgaggtgattttcgag
tgtgtcggagcaccgggcttattacagcagtgcatcgagatggcgggacatggcgggcag
attgtgccggtgggcgtgtgcgaacagcccgacgctattatgcccatgctcgggttgttc
aaggagctgcggattcagttcgctatcgcctacaccatggatgatttccagacggccatg
tctgccttggccgaacagcgtatcgatgtacagccgatgattaccgatatcgtgacgttg
gatgaattgccggcggcatttgaggccctgcggacaccgcaggatcagtgcaaggtattg
atcaagatagactga

DBGET integrated database retrieval system