KEGG   Halioglobus japonicus: BST95_17775Help
Entry
BST95_17775       CDS       T04687                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
hja  Halioglobus japonicus
Pathway
hja00970  Aminoacyl-tRNA biosynthesis
hja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hja00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BST95_17775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hja03029]
    BST95_17775
Enzymes [BR:hja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BST95_17775
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BST95_17775
Mitochondrial biogenesis [BR:hja03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BST95_17775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AQA19820
UniProt: A0A2N5YFD8
LinkDB All DBs
Position
3777187..3778653
Genome map
AA seq 488 aa AA seqDB search
MHQLTVAELSAGLRNKRFSSVELTSTYLGRIERLNGDLNAFITVDREAALAAAAEADTLL
ASGQGGPLTGVPIAHKDIFCTEGMRTSCGSRILDNFVPPYDATVIRRFRDAGAVILGKTN
LDEFAMGSSNENSFYGAAHNPWDLSLVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPA
AFCGITGLKPTYGRVSRLGMIAYASSLDQGGPMGHTAEDCALLLNVMAGHDPLDSTSSEQ
ATEDYTAALNNDLQGLRIGLPAEYFGDGLDPATGECIQAALRELEAQGAELVEISLPNAA
LTIPAYYIIAPAEASTNLSRFDGVRYGHRCDTPADLHDLYTRTREEGFGDEVKRRILVGT
YALSAGYYDAYYKKAQQARRLIRDDFMAAFDKVDVIAGPTTPGPAFALGAKSNDPVAMYL
EDVYTLAVNLAGLPGISTPAGLVDGKPVGLQLIGRHFEESRLLNVSHRLQQATDWHKAMP
AIAEGGAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaattgactgttgccgagctgtccgcgggattgcgaaacaaacgcttttccagt
gtcgagctcaccagcacttatctcggccgtattgagcggttgaacggcgatctgaacgcc
tttatcaccgtagatcgcgaagcggcgcttgccgctgccgccgaggccgacaccctgctg
gccagcggccagggtggcccactgacgggtgtacccattgcccataaagacatcttctgc
accgaaggcatgcgcaccagctgcggctcgcgcatactcgacaactttgtgcccccctac
gacgccaccgtgattcgccgcttccgcgacgccggcgcagtcattctgggtaaaaccaac
ctggatgagttcgccatggggtcctccaacgagaacagcttctacggcgctgcccacaac
ccctgggacctgtcgctggttccaggcggatcctcgggcggctctgccgctgccgtcgct
gcccgactcgccccggcagccaccggtactgacaccggcggctccatccgtcagcctgcg
gcgttctgtggcatcaccggcctcaagccgacctacggccgagtctcgcgcctgggcatg
attgcctatgcctctagcctcgatcagggcggccccatgggccataccgccgaggactgc
gccctgctgttgaatgtaatggccgggcacgaccctctggactccacctcttccgaacag
gccaccgaagattatacagctgcactgaacaacgacctgcagggcctgcgcatcggtttg
cccgccgaatattttggcgacggactggatccggcaacgggcgaatgcattcaggcagcg
ctcagggaacttgaggcccagggcgccgagctggtggaaatttcccttcccaatgccgcc
ctgacgattccggcctactacatcatcgcgccggcggaggcctccaccaacctgtcgcgc
tttgatggcgttcgctacggccaccgctgcgacaccccggccgacctgcacgacctgtat
acccggacccgggaagagggttttggcgacgaggtgaagcgccgcattctggtgggcacc
tacgcgctctcggccggctactacgacgcctactacaagaaagcacagcaggcacgccgc
ctgatccgcgacgactttatggccgccttcgacaaagttgatgttatcgccggccccacc
acaccaggtccggctttcgcactgggcgccaagagcaatgacccggttgccatgtacctg
gaagatgtctacacactggccgtcaacctggccggtctgccgggcatctccaccccagca
ggcctggttgatggcaagccggtgggcctgcaactgattggtcgccactttgaagaatcg
cgtctgctgaacgtgtcacaccgcctgcagcaggccaccgactggcacaaagccatgcct
gccatcgccgaaggaggtgccgcctga

DBGET integrated database retrieval system