KEGG   Halalkalicoccus jeotgali: HacjB3_00720Help
Entry
HacjB3_00720      CDS       T01271                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00564  Glycerophospholipid metabolism
hje01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hje00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HacjB3_00720
Enzymes [BR:hje01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HacjB3_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 Pyr_redox GIDA ApbA NAD_binding_7 3HCDH_N Pyr_redox_3 HI0933_like PALP Lycopene_cycl Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADJ13537
UniProt: D8J4H5
LinkDB All DBs
Position
complement(148571..149797)
Genome map
AA seq 408 aa AA seqDB search
MECMDTVLVIGGGATGAGVARDLAMRGVDVTLVERGDFASGTSGRSHGLLHSGARYVPGD
PEGAAECIAENRVLKEIAPHCLSDTAGLFVQVAGDDPDFFEEKRAACEQLGIETEELSAA
DAREAVPDLAEGVERALRVPDAVIHPTRLTVANAVDAREHGATLLPRTEVADLIIEDGAV
RGALVEDGSGEFEIRAEYVVNATGAWAGTLASMADIDLEMAPSSGVMVAVEYADLDTVLN
RARPAADGDIVVPHDEQVILGTTSVDVEDPDEFERDDAEIDRMFAECGAMLSGLDRERID
RVYWGVRPLYSADRERHAGRGISRGFHLLDHAERDGIGGFASIVGGKLTTYRAMAEATSD
RVCKRLGVDSACSTAEEPLLGRDEPGRIDGLVAEFEADNPADSDVIAR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtatggacacggtcctcgtgatcggcggcggggcgactggcgcgggcgtggcc
cgcgatctggcgatgcgcggggtggacgtgacactcgtcgagcgcggcgacttcgcaagc
gggaccagcggtcgctcgcacgggctccttcacagcggggcgcgctacgtccccggcgac
cccgagggcgcagcggagtgcatcgcggagaaccgcgttctcaaagagatcgccccccac
tgtctcagcgacaccgccggactgttcgttcaggtcgcgggcgacgaccccgatttcttc
gaggaaaagcgcgcagcctgcgagcagttgggaatcgagaccgaggagctgtcggcagcc
gacgctcgcgaggcggttcccgacctcgccgagggggtcgagcgcgcgcttcgcgtgccc
gacgccgtgatccacccgacccggttgacggtcgcgaacgccgtcgacgcccgcgaacac
ggggcgaccctcctcccacggaccgaggtggccgacctcatcatcgaggacggcgcggtc
cgaggggcgctcgtcgaggacggctcgggcgagttcgagatccgcgcggagtacgtcgtc
aacgcgaccggcgcgtgggccgggacgctcgcgtcgatggcagacatcgacctggaaatg
gcaccctccagcggcgtgatggtcgccgtcgagtacgccgatctggacaccgtgctcaac
cgtgcgcgaccggccgccgacggcgatatcgtggtcccccacgacgagcaggtgatcttg
ggaacgaccagcgtcgatgtcgaggaccccgacgagttcgagcgcgacgacgcggagatc
gaccggatgttcgcggagtgtggcgccatgctttcggggctcgaccgcgagcggatcgac
cgggtctactggggggtccgcccgctgtacagcgcggatcgcgagcgccacgctggacgg
gggatctcgcggggctttcacctgctcgatcacgcggagcgcgacgggatcggggggttt
gcgagcatcgtcggcgggaagctcacgacctaccgagcgatggccgaagcgacgagcgac
cgcgtctgtaaacgactgggggtcgactcggcgtgttctaccgccgaggagccgcttttg
ggtcgcgacgaaccgggacggatcgacgggctcgtcgcggagttcgaggccgacaacccc
gccgattcggacgttatcgcccggtag

DBGET integrated database retrieval system