KEGG   Haematospirillum jordaniae: AY555_08990Help
Entry
AY555_08990       CDS       T04366                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo00620  Pyruvate metabolism
hjo01100  Metabolic pathways
hjo01120  Microbial metabolism in diverse environments
hjo01200  Carbon metabolism
Module
hjo_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AY555_08990
Enzymes [BR:hjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AY555_08990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AMW35668
UniProt: A0A143DHJ1
LinkDB All DBs
Position
complement(1905450..1907750)
Genome map
AA seq 766 aa AA seqDB search
MKTPNENLDDLALYYHRSPRPGKIAVVATKPMATQRDLALAYSPGVAAACRAIVDNPAAA
YDVTSRGNMVAVVTNGTAVLGLGAIGPLAAKPVMEGKAALFKKFAGIDAFDIEINAETAD
DMVRIIAALEPTFGAVNLEDIKAPECFEVETRLRGMMGIPVFHDDQHGTAIVVGAAVHNG
LHLVGKKIEDIKLVSTGGGAAGLACLNLLVGMGLKRENVTLFDKFGLVYADRVEDMNPHK
SVYARSDLPRSTTLGQAMEGADVFLGLSGPGVLAKDMVAGMAPRPIVMALANPTPEIMPD
EVKAVRDDAIIATGRSDYPNQVNNVLCFPFIFRGALDVGATDVNMPMQIACVEAIAELAR
SETHDVVASAYVGEKLGFGAEYILPKPFDPRLIQVIAPAVARAAMETGIATRPIADLERY
RQDLGQYVFRSGQTMRPVMDRARQECRRVVYAEGEDDRVLRAAQAALDERVARPLLIGRR
SAILDQIANLGLRMRPDKDIEIIEIIRDPRYHNFSDAYWRLMRRKGVSPEHARMLVRSNS
TIFAAMMVRRNEADAMICGTAGRYVEHLTNLRDVLGLREGVAVCASMNAVILEKGTFFIA
DTNVNHDPTAEELCAITLMAADEVRRFGIEPKVALLSHSNFGTSNSPSALKMRKALELVN
QAAPDLEIEGEMHADSALSESIRERIFPGSRLNGQANLLIAPSVDAANISFNMIKVLGDG
LPLGPVLLGLGHPAHIVTPSVTVRGLLNMTALSVVDAQIFAAKKQE
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactccgaatgaaaaccttgacgatctcgccctttactatcaccgctcgccgcga
ccaggaaagattgccgttgttgcgaccaagccaatggcaacccagcgtgatttggccttg
gcctattcgccgggggttgctgcggcgtgtcgggcaatcgtggataatcctgctgctgcc
tatgatgtgacatcacggggcaatatggttgctgtcgtgaccaatggcaccgctgttttg
ggcttaggggcaatcggccccttggctgccaagccggtgatggagggcaaggcagccctt
ttcaagaaatttgcgggtatcgatgcgtttgacatagagatcaacgctgagacagccgac
gatatggtgcgcattattgccgcattggaaccgacctttggtgctgttaatctggaagat
atcaaggcccctgaatgctttgaggttgagacccggttgcgcggcatgatggggattccc
gtttttcatgacgatcagcatggtacagcgattgtagttggtgctgccgttcacaatggc
ttgcacttggtcggaaaaaagattgaagacataaagctggtatcgactggcggcggtgct
gctggtctggcctgtctcaatcttctggttggtatggggttaaagcgcgagaatgtcacg
ctgttcgacaagtttggtctggtgtatgcggatcgtgtggaggatatgaatcctcacaaa
tcggtctatgctcggtctgatttgccacgttcgaccacgttaggtcaggcgatggaaggg
gctgatgtattccttgggctttccggtcctggcgtccttgccaaggatatggttgcagga
atggcgccccggccaattgttatggcgctggccaatcccacacccgagatcatgcccgat
gaggtgaaagcggtaagggatgatgccattatcgctacgggacggtctgattatcccaac
caggtcaataatgttttgtgctttccttttattttcagaggggcgctggatgttggggca
acagatgtcaacatgcccatgcaaattgcctgtgtggaagccattgcagaactggcacgc
tctgaaacgcatgatgtcgtggccagcgcctatgttggggagaagctgggtttcggggct
gaatacattcttccaaagccgtttgatccccgcctgatacaggttatcgccccggcagtt
gcacgggcggccatggagacaggcattgcaacccgccccattgctgatctggagcggtat
cggcaggatcttgggcagtatgtttttcgttctggccagacaatgcgcccggttatggat
cgggcccggcaggaatgtcgccgtgttgtttatgcagaaggtgaggatgatcgcgttctt
cgtgcagctcaagccgctctggatgagcgtgttgcgcgccctctgttaatcggtcgtcgt
tcagccattttagatcagatcgccaatctgggtttgcggatgcgcccggacaaggatatc
gaaattatcgaaattataagggatccccgctatcacaacttttcagatgcgtattggaga
ttgatgcgtcggaaaggtgtttcgcctgagcacgcccgtatgttggttcgttcaaactcc
accatttttgcggccatgatggtgcgacgtaacgaagctgacgccatgatctgcgggacg
gcagggcgttatgtcgagcatttgacaaatttgcgcgatgttctggggttgcgtgaaggc
gttgctgtctgcgcatccatgaatgcggttattctggagaaaggtactttcttcattgcg
gataccaacgttaatcatgatccgacagcggaggaactctgcgccattaccttgatggct
gcggatgaggttcgccgctttggtatcgagccgaaagtggctttgttgtcacattcgaat
ttcgggacgtccaacagcccttcagccctgaaaatgcgtaaggccttggaacttgttaac
caagcagcccctgatttggaaatagagggagaaatgcacgcggattctgctctatctgaa
agcatacgtgaacgtatatttccgggtagtcgcctgaatgggcaggcaaacctgctgatt
gcaccttctgttgatgcggccaacatttcctttaatatgatcaaagtgttgggggatggg
ttgcctttagggccagtcttgttgggacttgggcatcctgcacatatcgtaacgccatca
gttacagtgcgcggtctgttaaatatgacggctctttcggttgttgatgctcagattttt
gccgccaagaaacaggagtaa

DBGET integrated database retrieval system