KEGG   Haematospirillum jordaniae: AY555_10535
Entry
AY555_10535       CDS       T04366                                 

Definition
(GenBank) hypothetical protein
  KO
K11006  shiga toxin subunit A
Organism
hjo  Haematospirillum jordaniae
Pathway
hjo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hjo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AY555_10535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hjo02042]
    AY555_10535
Bacterial toxins [BR:hjo02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    AY555_10535
SSDB
Motif
Pfam: RIP
Other DBs
NCBI-ProteinID: AMW35805
UniProt: A0A143DGF2
LinkDB
Position
unnamed2:77418..78386
AA seq 322 aa
MNQSSAGEEALRITRRDRGYSIVTMAALNEDNRSVLQQVDLVVRNNDLYVLGFINGRPGH
RVFHRMYEPPPYRYATADTSAIPLDLTIPDTIARNLNMSYDYPNLEQKANMRRYGGNFRS
SIRTVRSAIATLAEHNAANDDEDSTSDVARALLRIIVTYFEGMRFHNLSQSIHDAGFDSG
RTWTMTQDEALITNSWRPLSDFGSQMSLDSSSRESSPRLELSHSRNSPYGSRLYIASSMS
DHGMDWRAVLAVALSSRWTLNRRGSCPSRIGHHRAPRDTNSIMSYFSDLADDFCSTMLVR
VGNTYFDRTRGFGIISTILEDK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaatcaaagtagcgccggtgaggaggccctacgcatcacccggcgggacagagggtat
tcaattgtaaccatggcagccctgaatgaagataacagaagcgttttgcagcaagttgac
ttggttgtgcgcaataatgacctgtacgtcttgggattcatcaacggtcgcccaggtcat
cgtgtattccacagaatgtatgaaccgccaccgtaccgttatgcgactgccgatacctca
gcaattcctcttgacctgaccattccggacaccatagccagaaacttgaatatgtcctac
gactatccaaatctggagcagaaagccaatatgcggcgctatggcggcaatttccgctct
tccatacgaacggtacgctcggccattgcaacacttgcagaacataacgctgccaatgac
gatgaagacagcacctctgacgttgctcgtgcacttctacggattatcgtaacctatttt
gaaggcatgcgattccacaatctgtcgcagagcatccatgacgccggctttgacagtggc
cgcacatggaccatgacacaagacgaggcattgatcacaaacagctggcgcccactcagt
gacttcgggtcacaaatgtccttggacagcagcagccgtgaaagttcaccacgcctggag
ctttctcacagcagaaatagcccttacggatcacgtctttatattgcctccagcatgagc
gaccatggaatggactggcgcgcggtgcttgctgttgcgctctccagccggtggacgctg
aatcgccgaggaagctgcccatcccgcatcggccatcatcgcgcaccgcgtgatacaaac
tctattatgagttacttttctgaccttgctgatgatttttgctccacaatgctggtgcgc
gttggcaatacctacttcgacagaacccgtggctttgggattatttctaccattctagaa
gacaaatag

DBGET integrated database retrieval system