KEGG   Halorubrum lacusprofundi: Hlac_0018
Entry
Hlac_0018         CDS       T00856                                 

Definition
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hlac_0018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hla01007]
    Hlac_0018
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hla03016]
    Hlac_0018
Enzymes [BR:hla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     Hlac_0018
Amino acid related enzymes [BR:hla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Hlac_0018
Transfer RNA biogenesis [BR:hla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Hlac_0018
 Prokaryotic type
    Hlac_0018
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1e DZR Anticodon_3 Zn-ribbon_8 tRNA-synt_1f SpecificRecomb DUF6487
Other DBs
NCBI-ProteinID: ACM55624
UniProt: B9LQM2
LinkDB
Position
1:15448..18126
AA seq 892 aa
MPSGEYDPDTVEPRWQRRWVDEETYAYPDDDPVDPNTVFSIDTPPPTVSGSLHMGHLYGF
TLQDFVARFERMNGGETFFPFGYDDNGIASERLTEDELDIRHQDFERREFQAKCREVCAE
YEAQFTENVQSLGVSVDWDHTYQTIEPRVQRISQLSFLDLYDQGREYREKAPAIWCPECE
TAISQVETEDDEQASHFHDIAFPVVGGDATDDGAEEFVISTTRPELLPACVAVFVHPDDD
ENQNLVGESAEVPLFGHEVPIIADERVDMETGSGIVMCCTFGDQNDIEWYQVHDLNLRVA
IDESGHMTDVAEGYEGMHADEAREAIVEDLDGAGALLDRRDITHTVNVHERCGTSVEFLV
TEQWYVEMLDKTDEYLEIGREMEWSPEKMFTRYEHWVEGLQWDWLISRQRSSGIPFPVWY
CEDCGEIVVAEKADLPVDPLSDDPPVDACPECGHDEFEPEDDVLDTWATSSLTPLINAGW
DWDEDAGEFTMEHPELYQFDLRPQGHDIISFWLFHTLVKCYEHTGEVPFEETMINGHVLD
ENREKMSKSVGNVVEPEAVLAEFPVDATRYWAAGTAVGDDFPFKEKDLRAGEKLIRKLWN
ASKLVESLAPEPYPDTPADEDLRELDRWLLAELDDRIERLTGLFEDRAFSKARDELRSFF
WNTFCDDYLEIVKQREDDAAAYTLRTAHRRFLKLFAPLLAHVTEELWHDMYADGASDPDA
VDAAVADGARDSIHLADWPEPLGLEADHEAGAAATAVVGALRKYKSKNQLPLNAELDAVE
VYADVRGFEEDITGVMHVADLTVHPDEDAPVETVITGIDLDYATVGPKYGDQVGDIEAAL
AKEEYEIDGEELHVTGVTLVEEEFAIEEERQYQGDGELLEADDVVVIVRNEA
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgcccagtggtgagtacgacccagacaccgtcgagccgcggtggcagcggcgatgggtc
gacgaggagacgtacgcctaccccgacgacgacccggtcgatccgaacacggtcttctcc
atcgacacgcccccgccgacggtatcggggagcctccacatgggccacctgtacggcttt
accctccaggacttcgtcgcccgattcgagcgcatgaacggtggagagacgttcttcccg
ttcggctacgacgacaacggtatcgcctccgagcggctcaccgaggacgaactcgatatc
cgccaccaggacttcgaacgccgggagttccaggcgaaatgtcgggaggtctgtgccgag
tacgaggcgcagttcaccgagaacgtccagtcgctcggcgtctcagtcgactgggaccac
acttaccagacgatcgagccgcgcgtccagcgcatctcccagctgtcgttcctcgacctg
tacgatcagggtcgcgagtaccgcgagaaggcgcccgcgatctggtgtcccgagtgcgag
accgccatctcgcaggtcgagaccgaggacgacgagcaggccagccacttccacgatatc
gccttccccgtggtcggaggcgacgcaaccgatgacggcgccgaggagttcgtcatctcg
acgacgcgccccgaacttctccccgcgtgcgttgccgtcttcgtccaccccgacgacgac
gagaaccagaacctcgtcggtgagtccgccgaggtcccgctgttcggccacgaggtgccg
atcatcgccgacgagcgcgtcgacatggagacgggttccggcatcgtgatgtgctgtacg
ttcggcgaccagaacgatatcgagtggtaccaggtccacgacctgaacctccgggtcgct
atcgacgagtccggacatatgaccgacgtcgccgaggggtacgaagggatgcacgcagac
gaggcccgcgaggctatcgtcgaagacctcgacggggcgggcgcgctgctggaccgccgc
gatatcacccacaccgtcaacgttcacgagcgctgcgggacgagcgtcgagttcctcgtc
accgagcagtggtacgtcgagatgctcgacaagaccgacgagtacctcgagatcggccgg
gagatggagtggtctccggagaagatgttcacccggtacgagcactgggtcgaggggctc
cagtgggactggctcatctctcgtcagcgctcctcgggcatcccgttcccggtgtggtac
tgcgaggactgcggggagatcgtcgtcgccgagaaggccgacctgcccgtcgaccccctc
tcggacgacccgccggtcgacgcctgtcccgagtgcggccacgacgagttcgaacctgaa
gacgacgtgctcgacacgtgggccacctccagcctgaccccgctcatcaacgccggctgg
gactgggacgaggacgccggggagttcaccatggaacaccccgaactgtaccaattcgac
ctccgaccacagggccacgatatcatcagcttctggctgttccacacgctggtgaagtgc
tacgagcacaccggtgaggttccgttcgaggagacgatgatcaacggccacgtcctcgac
gagaatcgggagaagatgtcgaagtccgtcggtaacgtcgtcgagccggaggcggtgctg
gcggagttcccggtcgacgccacgcgctactgggccgccgggaccgccgtcggcgacgac
ttcccgttcaaagagaaggacctccgcgcgggcgagaagctgatccgcaagctgtggaac
gcctctaagctcgtcgagtcgctggcgccggagccgtacccggatacgccggccgacgaa
gacctccgagagctcgaccgctggctgctcgccgagctcgacgaccgaatcgagcgactc
actgggctcttcgaggatcgcgcgttctcgaaggcccgcgacgaactccggagcttcttc
tggaacacgttctgtgacgactacctcgagatcgtcaaacagcgcgaggacgacgccgcg
gcgtacacgctccggacggcacaccggcggttcctgaagttgtttgccccgctgctcgcg
cacgttaccgaagagctctggcacgacatgtacgccgatggagcgagcgaccccgacgcg
gtcgacgccgccgtcgccgacggcgcgcgcgactcgatccacctcgccgactggcccgag
ccgctcggtctggaggcagaccacgaggctggtgcggccgccacggcagtcgtcggtgcc
ctccgaaagtacaagagcaagaaccagctcccgctgaacgccgagctcgatgccgtcgag
gtgtacgccgatgtccgcgggtttgaggaggacatcacgggcgtgatgcatgttgcggac
cttaccgtccatcccgatgaggacgccccggtcgagacggtgatcaccgggatcgacctc
gactacgccaccgttgggccgaagtacggtgatcaggtcggggacatcgaggcggcgctc
gcgaaagaggagtacgagatcgacggcgaggagctccacgttacgggtgttacgcttgtc
gaggaggagttcgcgatcgaggaggagcgacagtaccagggcgacggcgagctgttagag
gcggacgacgtggtcgttatcgtccgtaacgaggcgtag

DBGET integrated database retrieval system