KEGG   Halorubrum lacusprofundi: Hlac_0150
Entry
Hlac_0150         CDS       T00856                                 

Definition
(GenBank) DNA polymerase II, large subunit DP2
  KO
K02322  DNA polymerase II large subunit [EC:2.7.7.7]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla03030  DNA replication
Brite
KEGG Orthology (KO) [BR:hla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Hlac_0150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hla03032]
    Hlac_0150
Enzymes [BR:hla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Hlac_0150
DNA replication proteins [BR:hla03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    D-family DNA polymerases
     Hlac_0150
SSDB
Motif
Pfam: PolC_DP2 Intein_splicing TackOD1 Sigma70_ner DUF4402
Other DBs
NCBI-ProteinID: ACM55755
UniProt: B9LRD2
LinkDB
Position
1:156012..160112
AA seq 1366 aa
MRPDDERYFAQIEDRLDEAWDVAEAAKEQGHDPKPKIEIPIARDMADRVENILGIDGVAE
RVRELEGEMSREEAALELVTDFVEGTVGDYDSRAGKVEGAVRTAVALLTEGVVAAPIEGI
DRVELLENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLDIDEYKPRDVEVERY
AEEISLYDKETGLQYSPKDKESKFIAQHMPVMLDGEATGDEEVSGFRDLERVDTNSARGG
MCLVAAEGIALKAPKIQRYTRDLDEVDWPWLQDLIDGTIGKDGGGASDEAPENAGAEGDD
DSEDTAGNESDGDDADDADSETDGPAGPLRPKSSQKFLRDLIAGRPVFTHPSEAGGFRLR
YGRARNHGFATGGVHPATMHLVDDFLAAGTQIKTERPGKAHGVIPVDSIEGPTVRLANGE
VRRIDDPEEAKEIRNGVEKVLDLGEYLVNYGEFVENNHPLAPASYVYEWWVQEFETAGAD
VQAMRDDPHVDLEHPDVDEALAWAREYDCPLHPEYTYLWHDVSVDAFEALADAVAAGDVV
EGVLAIERTETTQHALESLLVQHVATPDALRIPTWRPLARSLGIDDGLRKTWSADDLSAA
AREWDDGENAVKAINEVAPFEIRERAPTRIGNRMGRPEKSESRDLSPAVHTLFPINEAGG
PQRDVAEAAGTMDDSGHRGRLDLEVSDRVCPDCGEHTYRAQCPDCGVHTDLHYECGDCGT
VCEPDEAGRVECPRCEWEVTAATYQEVDLNDAYRSALETVGERESAFEILKGVQGLTSRN
KTPEPIEKGVLRAKNGVTSFKDGTVRYDMTDLPVTSVRAEELDITADHLREIGYETDIDG
EPLRHDDQLVELRVQDIVLSDGAAEHMLKTAGFVDDLLEQFYGLDRFYEFNERDDLVGEL
VFGMAPHTSAATVGRVVGFTSAAVGYAHPYFHAAKRRNCFHPETEIEYRDDAGWHRETIE
KFVEERLNDPQTDDFGTLVNELDGNVEVPSIDEHGNKSTQPVTAVSKHLSQDHLVQVETQ
RGRSIRVTPDHTMLRVADGGVQKVAANELEIGDSVPTTTLRHEMSVGATVDVTTDGGIEA
DTVASVDFLESDIEHTYNLTVAETHTLAANDLLVAQCDGDEDCVMLLMDGLLNFSKTFLP
DQRGGRMDAPLVMSSRIDPSEIDDEAHNVDIAREYPREFYDATLEMADPESVEDLIQIGE
DTLGTDEEYHGFGHTHDTTDIAMGPDLSAYKTLGDMMEKMDAQLELARKLRAVDETDVAE
RVIEYHFLPDIIGNLRAFSRQKTRCLDCGEKYRRMPLSGDCRECGGRVNLTVHEGSVSKY
VDTAIEVADRFGCRPYTKQRLKVLDQSLESIFEDDTNKQSGIADFM
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgaggccggacgacgagcgctacttcgctcagatcgaagaccggctcgacgaggcgtgg
gacgtggccgaggccgccaaggagcagggtcacgacccgaaaccgaagatcgagatcccg
atcgcccgcgatatggccgaccgggtcgagaacattctcggaatcgacggggtcgcggag
cgcgtccgcgagttggaaggcgagatgtcccgcgaggaggcggccctcgaactcgtcacc
gacttcgtcgaggggaccgtcggcgactacgactcccgggccggcaaggtcgaaggcgcg
gtccggaccgcggtcgcgctgctcaccgagggggtcgtcgccgcgccgatcgaggggatc
gaccgggtcgagctgctggaaaacgacgacggcaccgaattcgtcaacgtctactacgcc
ggtccgatccggtctgcgggcgggaccgcgcaggcgctgtccgtgctcgtcgccgactac
gcccgatcgttgctcgacatcgacgagtacaagccgcgagacgtagaggtcgagcgctac
gccgaggagatctcgttgtacgacaaggagacaggcctccagtactcgccgaaggacaag
gagtcgaagttcatcgcacagcacatgcccgtcatgctcgacggggaagcgacgggcgac
gaggaggtctccgggttccgcgatctggaacgcgtcgacaccaactccgcgcgcggcggg
atgtgtctcgtggccgccgaagggatcgcgctgaaggccccgaagatccagcggtacacc
cgcgacctcgacgaggtcgactggccgtggctgcaagatctgatcgacggaacgatcggc
aaggacggcggcggcgcgagcgacgaggctcccgagaatgccggcgcagagggagacgac
gacagcgaggacaccgcgggcaacgagagcgacggggacgacgcggatgatgccgattcg
gaaaccgatggccctgctggccccctccgtccgaagtcctcacagaagttcctccgggac
ctgatcgcaggccgtcccgtctttacccacccgagtgaggcgggtggattccgacttcga
tacggtcgcgcgcgcaaccacgggttcgcgaccggcggggtccacccggcgaccatgcac
ctcgtcgacgacttcctcgcggcgggcacccagatcaagacggagcgtccggggaaagcc
cacggggtcatccccgtcgactccatcgaggggccgaccgtgcgactcgcgaacggcgag
gtccggcggatcgacgaccctgaggaggcgaaggagatccggaacggcgtcgagaaagtg
ctcgatctcggcgagtatctcgtcaactacggcgagttcgtcgagaacaaccacccgctc
gcgcccgcctcgtacgtctacgagtggtgggttcaggagtttgagaccgccggtgccgac
gtgcaggccatgcgggacgacccccacgtcgaccttgaacaccccgatgtcgacgaggcg
ctcgcgtgggcgcgcgagtacgactgtccgcttcacccggagtacacgtacctctggcac
gacgtgtcggtcgatgcgttcgaggcgctcgcagatgcggttgccgccggcgacgtggtc
gagggcgtcctcgcgatcgagcgcacggagacgacgcagcacgcgctggagtcgctgctg
gtccaacacgtcgcgacgccggacgcgctccggatccccacgtggcgcccgctggcgcgg
tcgctcggaatcgacgacgggctccgaaagacgtggagcgcggacgacctctcggcggcg
gcccgcgagtgggatgacggtgagaacgcggtgaaagccatcaacgaagtcgctcccttc
gagattcgcgagcgggcgccgacccggatcggcaaccggatgggccgcccggagaagtcg
gagagccgtgacctctcgccggcggtccacaccctgttcccgatcaacgaggccggcggc
ccccagcgcgacgtggcggaggccgcggggacgatggacgactcgggccaccgagggcgg
ctggacctggaggtctccgaccgggtgtgccccgactgtggcgagcacacgtaccgggcg
cagtgcccggactgcggggtccacaccgacctccactacgagtgcggcgactgcggcacc
gtctgcgagcccgacgaggccggccgcgtcgagtgcccgcgctgcgagtgggaggtgacg
gcggcgacctaccaggaggtcgacctcaacgacgcgtaccgctccgcgctggagaccgtc
ggcgagcgggaatccgccttcgagattctgaagggcgttcaggggctcacctcgcggaac
aagacccccgagccgatcgagaagggggtcctccgcgcgaaaaatggtgtcacatcgttc
aaggacggcaccgtcaggtacgacatgaccgacctcccggtcacgtcggtccgcgccgag
gagctcgacatcaccgccgaccacctccgagagatcggttacgagacagatatcgacggc
gaacccctgcgccacgacgatcaactggtggagcttcgggtgcaggacatcgtcctctcc
gacggcgctgccgagcacatgctcaagactgcgggcttcgtcgacgacctcttagagcag
ttctacgggctcgaccgcttctacgagttcaacgagcgcgacgacctcgtcggcgagctc
gtcttcgggatggcgccgcacacgagcgccgcaactgtcgggagagtggtgggtttcacg
tcggccgccgtgggatacgctcatccgtactttcacgccgccaagcggcgcaactgcttc
cacccggagacggagattgagtatcgagacgacgcagggtggcaccgcgagaccatcgag
aaattcgttgaggagcgactgaatgatccccagaccgacgacttcggaacactcgtcaac
gaactcgatggcaacgtcgaggttccttcgatcgacgaacacggaaacaagtcgacacag
ccggtgactgccgtctcgaaacacctgagtcaggaccatctcgtccaggtcgagacccag
cgcggacgttcgattcgcgtgacacccgaccacacgatgctgcgagtcgcggatggaggc
gttcaaaaggtcgctgcaaacgaactggagatcggcgattcggtcccgacgacaactctt
cgtcacgagatgtcggtgggcgctactgtcgacgtgacgacggacggggggatcgaggcg
gacacagttgcctcggtcgatttcctcgaaagcgacatcgaacacacttacaatctcaca
gtcgccgagacgcacacgctcgcggcgaacgatttactggtcgctcagtgtgacggagac
gaggattgcgttatgctcctcatggacggacttctcaacttctcgaagacgttcttaccg
gaccaacgcggcggtcgtatggacgcgcccctcgtgatgtcctcgcggatcgacccgtcg
gagatcgacgacgaggcgcacaacgtcgacatcgcgcgggagtaccctcgcgagttctac
gacgcgacgctggagatggccgatccggagtcggtcgaggacctgattcagatcggcgag
gacacgctcgggaccgacgaggagtaccacgggttcggccacacccacgacacgacggac
atcgcgatgggacccgatctgtcggcgtacaagacgctcggcgacatgatggagaagatg
gacgcccagctggagctggcccggaagctgcgcgcggtcgacgagacggacgtggccgag
cgcgtgatcgagtaccacttcctgccggacatcatcgggaacctccgggcgttctcgcgg
cagaagacgcggtgtctcgactgcggcgagaagtaccgacggatgccgctatctggcgac
tgccgcgagtgcggcgggcgggtgaacctcaccgtccacgaggggtcggtgagcaagtac
gtcgacacggcgatcgaggtcgccgatcggttcggctgccggccctacacgaaacagcgg
ttgaaggtgttagaccagtcgctggagtcgatcttcgaggacgacaccaacaagcagtcg
ggtatcgcggacttcatgtga

DBGET integrated database retrieval system