KEGG   Halorubrum lacusprofundi: Hlac_0221
Entry
Hlac_0221         CDS       T00856                                 
Name
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00071  Fatty acid degradation
hla00280  Valine, leucine and isoleucine degradation
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hlac_0221
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hlac_0221
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     Hlac_0221
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-ProteinID: ACM55826
UniProt: B9LRK3
LinkDB
Position
1:complement(238970..240190)
AA seq 406 aa
MEYDDIGRGPEIAEAVREFVDETVLPVEREWLGRGPIPPADIEALRDAARDEGIYAPQVA
EEYGGLGLGFREMLPVFEEAGRSLLGPTALRCAAPDEGNMHTLEIAATDAQKERWLRPLA
AAEIDSGFAMTEPMQGGGSDPKMLATTAEKDGDEWVIDGHKWWTTGGVEANLLLVFARTD
QEAHPYAGCSVILVPADADGVEVVRNIPHLGEGLVGTTHAEIRFDDVRVPVENTLGEENE
GFTLVQQRLGPARLTHCMRYAGMADRALDIATAYLSEREGFGEPLSEKQGPRFRIADRRT
ELHAARTMVRHAAGRIADGHEARIEVAMAKTFAANVTQEAIDDALQFCGGNGIAYDLPIA
RFHENVRQFRLVDGADEVHRRSIARDAFEDPPAEELETVTRFGEFD
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggagtacgacgatatcggtcgcgggccggagatcgccgaggccgtcagggagttcgtc
gacgagacggtgcttccggtcgagcgggagtggctcggccgaggaccgatcccgccggcg
gacatagaggcgctgcgcgacgccgcgcgcgacgaggggatctacgccccgcaggtcgcc
gaggagtacggcgggctcggactcgggttccgcgagatgctgccggtgttcgaagaggcg
ggccggagcctgctcgggccgacggcgctccggtgtgcggcgcccgacgaggggaacatg
cacaccctcgagatcgcggccaccgacgcacagaaggagcgctggctccgcccgttggcg
gccgcggagatcgactcggggttcgcgatgaccgagccgatgcagggcggggggtcggac
ccgaaaatgctggcgacgaccgccgagaaagacggcgacgagtgggtcatcgacggccac
aagtggtggacgaccggcggcgtcgaggcgaacctcctcctcgtgttcgcccgcaccgat
caggaggcgcatccgtacgccggttgttcggttatcctcgtgcccgccgacgccgacggc
gtcgaggtcgttcggaacatcccgcacctcggcgaggggctggtcgggacgacgcacgcc
gagatccggttcgacgacgtgcgcgtgccggtcgagaacacgctcggcgaggagaacgag
gggttcaccctcgtccaacagcggctgggtccggcccggctcacccactgcatgcggtac
gccgggatggccgatcgcgcgctcgacatcgcgaccgcctacctctccgagcgggagggg
ttcggcgaaccgctctcggagaagcaggggccgcggttccggatcgccgaccgccgcacc
gagctccacgccgcgcgcacgatggtccggcacgccgccgggcggatcgccgacggtcac
gaggcgcgcatcgaggtcgcgatggcaaagacgttcgcggcgaacgtgacgcaggaggcg
atcgacgacgcgctccagttctgcggcggcaacgggatcgcgtacgacctgccgatcgcg
cgcttccacgagaacgtccggcagttccgcctcgtcgacggcgccgacgaggtccaccgc
cggtcgatcgcgcgggacgccttcgaggacccgccggccgaggagcttgagaccgtcacg
cggttcggcgagttcgactaa

DBGET integrated database retrieval system