KEGG   Halorubrum lacusprofundi: Hlac_0304
Entry
Hlac_0304         CDS       T00856                                 

Name
(GenBank) Inorganic pyrophosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Hlac_0304
Enzymes [BR:hla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     Hlac_0304
SSDB
Motif
Pfam: Pyrophosphatase
Other DBs
NCBI-ProteinID: ACM55908
UniProt: B9LS63
LinkDB
Position
1:complement(327152..327685)
AA seq 177 aa
MVNLWEDLETGPNAPDEIYAVVECLKGERNKYEYDKDIPSVVLDRVLHSNVHYPYDYGFI
PQSYYDDEDPFDVMVLVEDQTFPGCVIEARPVALMKMDDDGEQDDKVIAVPTEDPRFDHI
EDLSDLPQQTLDEIDEFFSTYKNLEAGKEVETLGWEDKQAARDAIEHAQDLYDEEFQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atggtcaatctctgggaagatctcgagacgggaccgaacgcgccagacgagatctacgcg
gtcgtagagtgtctcaaaggtgagcggaacaagtacgagtacgacaaggacatcccgagc
gtcgtcctcgaccgggtgctccactcgaacgtccactacccgtacgactacggcttcatc
ccgcagtcgtactacgacgacgaggaccccttcgacgtgatggtgctcgtcgaagaccag
acgttccccggctgcgtgatcgaagcccgtcccgtcgcactgatgaagatggacgacgac
ggcgagcaggacgacaaggtgatcgcggtgcccaccgaggacccgcggttcgaccacatc
gaggacctgtcagacctcccccagcagacgctcgacgagatagacgagttcttctcgacg
tacaagaacctcgaggcaggcaaggaggtcgagactctcggatgggaggacaagcaggcc
gcgagggacgcgatcgaacacgcgcaggatctgtacgacgaggaattccagtaa

DBGET integrated database retrieval system