KEGG   Halorubrum lacusprofundi: Hlac_0678
Entry
Hlac_0678         CDS       T00856                                 

Name
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
Organism
hla  Halorubrum lacusprofundi
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_22 AAA_21 MOSC ATP-synt_ab AAA_33 AAA_29 AAA_16
Other DBs
NCBI-ProteinID: ACM56280
UniProt: B9LUC3
LinkDB
Position
1:695655..696992
AA seq 445 aa
MTDEPILSVRDLKKHYPLRKGIFNRQVGAAKAVDGISFDIASGETLGLVGESGCGKSTAA
SSVIRLEEPTAGEVVFNGNGRGGATRNPDGTHPNDVTKFSDAELKRFRRGAQMIFQDPAS
SFDPRMTVGSAVAEMLEIHGMSDRHRRRAIVEDLLERVGLSAVDYDRYPHEFSGGQKQRI
ALARALVLNPDLIIADEPVSALDVSIQAEILSLIDDLQAEFDLSMLFISHDMSVIRRICD
RVAVMYLGEIVEVGPTDEIFADPQHPYTEALLSSIPTPDPRSSVGGIELTGTVPSPTNPP
SGCRFHTRCHRVIQPEGIDIDQSDWRGILNFRDRVAAGQVDVESIRENIVVEGGAASDND
VREQLRKEFDIGERLDDPEIEDTLREVIDRLLARDDEEAAELLSDRFSTPCAETTPERTV
HAEGHESACLRHESEHVVAASPIDG
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgactgacgagccgatactctcggtccgggatctgaagaaacactatccgctccggaag
gggatcttcaaccggcaggtcggcgccgcgaaggcggtcgacgggatcagcttcgacatc
gcgtccggcgagacgctggggctggtcggcgagtccggctgcgggaagtcaaccgccgcg
agttccgtcatccgcttggaggagccgactgccggcgaggtcgtgttcaacggaaacggc
cggggcggtgcgacccgcaacccggatggcacccacccgaacgacgtgaccaagttttcc
gacgcggagctcaagcgattccgccgcggggcccagatgatcttccaagatccggcgtcg
agcttcgacccgcggatgacggtcggcagcgcggtcgcggagatgctcgagatccacgga
atgtcggaccgtcaccggcggcgggcgatcgtcgaggacctgctcgaacgcgtcgggctc
tccgcggtggattacgaccgatacccccacgagttctccggcggccagaaacagcggatc
gcgctggcccgggcactcgtgttgaacccggatctcatcatcgccgacgagcccgtctcg
gcgctcgacgtgtcgatccaagcggagatcctctcgctcatcgacgacctccaagcggag
ttcgacctctcgatgttgttcatcagccacgatatgtccgtgatccgccggatctgtgac
cgtgtcgcggtgatgtacctcggtgaaattgtcgaggtcgggccgaccgacgagatcttc
gccgacccgcaacacccctacaccgaggcgttgctgtcgtcgatcccgacgccggatccg
cggtcgagcgtcggcgggatcgaactcaccggcacggtaccgagcccgacgaatccgccg
agcggctgccggttccacacgcggtgtcaccgcgtcatccagccggaggggatcgacatc
gaccagtccgactggcgcgggatactgaacttccgcgatcgcgtcgccgccggtcaggtc
gatgtcgagagcatccgggagaacatcgtcgtcgaggggggtgcggcgagcgacaacgat
gtgagagaacagctccgcaaagagttcgacatcggtgaacggctcgacgatcccgagatc
gaagataccctccgggaggtgatcgaccgactcctcgctcgcgacgacgaggaggcggca
gagctgctctcggatcggttcagtaccccgtgcgcggagacgactccggagcgaaccgtt
cacgctgagggacacgaatcggcgtgtctccgccacgagtcggagcatgtggtcgcggcg
agtccgatcgacggctga

DBGET integrated database retrieval system