KEGG   Halorubrum lacusprofundi: Hlac_0703
Entry
Hlac_0703         CDS       T00856                                 

Name
(GenBank) phosphoribosylaminoimidazole carboxylase, catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00230  Purine metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
Module
hla_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Hlac_0703
Enzymes [BR:hla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     Hlac_0703
SSDB
Motif
Pfam: AIRC
Other DBs
NCBI-ProteinID: ACM56305
UniProt: B9LUE8
LinkDB
Position
1:717921..718538
AA seq 205 aa
MTTVQDLIDRLEAEAAADADPETTPDVGIIMGSDSDLPTMEGAYDALDELGFAEQTDFDD
APDARFTYESYVVSAHRTPELMYAYGETAAARGLDIVIAGAGGKSADLPNMTASLAYPIP
VIGVPVQEKSVDSVIGMPTGAPIVAVDAGKSFNAGLSAAQVLAREHDAIEERLIEYHEEL
KGGVAEVSADLHDLGIDGFRDRNEP
NT seq 618 nt   +upstreamnt  +downstreamnt
atgaccacggtgcaggacctgatcgatcgactcgaagcggaggcggcggccgacgccgac
ccggagaccacccccgacgtggggatcatcatggggtcggactcggacctcccgacgatg
gagggggcgtacgacgcgctcgacgagctcgggttcgccgagcagaccgacttcgacgac
gcgcccgacgcgcggttcacctacgagagctacgtcgtctccgcgcaccggacgccggag
ctcatgtacgcgtacggggagaccgcggcggcccgggggctcgacatcgtgattgcgggt
gcgggtgggaaatccgctgacctcccgaacatgaccgcgtcgctcgcgtacccgatcccg
gtgatcggcgtcccggttcaggagaagtcggtcgactccgtcatcgggatgcccacgggc
gccccgatcgtcgcggtcgacgccggcaagtcgttcaacgcggggctctccgccgcgcag
gtgctcgcgcgcgagcacgacgcgatcgaggaacggctgatcgagtaccacgaggagctg
aaaggcggcgtcgcagaggtgtcggccgacctgcatgacctcggaatcgacgggttccgc
gatcggaacgagccgtag

DBGET integrated database retrieval system