KEGG   Halorubrum lacusprofundi: Hlac_0704
Entry
Hlac_0704         CDS       T00856                                 

Definition
(GenBank) NADH-ubiquinone/plastoquinone oxidoreductase chain 3
  KO
K00330  NADH-quinone oxidoreductase subunit A [EC:7.1.1.2]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00190  Oxidative phosphorylation
hla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Hlac_0704
Enzymes [BR:hla01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Hlac_0704
SSDB
Motif
Pfam: Oxidored_q4 FixQ
Other DBs
NCBI-ProteinID: ACM56306
UniProt: B9LUE9
LinkDB
Position
1:718685..719101
AA seq 138 aa
MSDWIAIGALAVVGLVIPLAMMSVSALLRPSVPETGKSTTYESGETPTGGTRIRFNIQYY
MVALLFVVFDIETVLLFPWAVIYRPAISAGVPMIDLLWPMLAFVGVLAVGLVWAWRSGAI
SWARSPRATSRKTERDLN
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagcgattggatagcgattggcgccttggcggtcgtcggcctggtcatcccgctagcg
atgatgtccgtgtcggcgttgctccgtccgagtgtgcctgagaccggtaaaagtaccacc
tacgagtccggcgagaccccgacaggcgggacgcggatccggttcaacatccagtactac
atggtcgcgctgttgttcgtcgtgttcgacatcgagaccgtgttactgttcccgtgggcc
gtcatctaccgtccggcgatcagtgcgggcgtgccgatgatcgacctactgtggccgatg
ttggccttcgtcggcgtcctcgcagtcgggctcgtctgggcgtggcgctccggcgccatc
agctgggcccggagtccccgcgcgaccagtcgaaagacggagcgtgacctcaactaa

DBGET integrated database retrieval system