KEGG   Halorubrum lacusprofundi: Hlac_1123Help
Entry
Hlac_1123         CDS       T00856                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00564  Glycerophospholipid metabolism
hla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hlac_1123
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hlac_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored DAO_C GMC_oxred_N Thi4 NAD_binding_8 Lycopene_cycl Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: ACM56717
UniProt: B9LMX9
LinkDB All DBs
Position
1:1130002..1131750
Genome map
AA seq 582 aa AA seqDB search
MDQQVDVVVVGGGSTGCGVVRDLARRGVDAVLVEKGNLTHGTTGRMHGLLHSGGRYAVSD
QKSARECIEENRVLRDIAGHCVEETGGLFVKRPEDSEEYFQEKLEGCRACDIPVEMIDGE
EARRREPYLARDVEKAIALPDAAVDPFRLCVANAADAREHGARIETHAPVTDVLVEDGEI
VGVEIEHETGPGKRVHREPGTTEEIRARHVVNATGAWAGNVGEMAGVDVEVRPSKGVMTV
MNTRQVDTVINRCRPKGDADIIVPHETACILGTTDEEVDDPEDYPEEEWEVDLMIETLSE
LVPMLKDARTLRSFWGVRPLYEPPGTGTEDPTDITRDYFLLDHGDRDDLPGMTTIVGGKL
TTYRMMAESISDHVCDALGHDATCDTADAPLPGSENPARMDELMEEFGLRSPVARRSGQR
LGSRAADVLDEYDPNPVVCECEGVTRAEVQDAIGEAGSDLNAVRIRTRASMGNCQGGFCT
HRIAAELAQEYPEPVVRDAEDELYQERWKGQRHALWGMQLSQAMLNHLLHATTMNRDGDP
ASLNSEVDFGAFDAGEGGSEADAIDGGDAGTAATDGGIDGDR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaggtggacgtcgtcgtcgtcggcggggggtcgacggggtgcggcgtcgtc
agggacttggctcgacggggggttgatgcggtgctcgtcgagaaggggaacctgacgcac
ggcacgacggggcggatgcacgggctcttacacagcggggggcggtacgcggtctcggat
cagaagagcgcgcgcgagtgcatcgaggagaaccgtgtgctccgcgacatcgcaggtcac
tgcgtcgaggagacgggcgggctgttcgtcaagcgaccggaggactccgaggagtatttt
caggagaagctagaggggtgccgcgcgtgcgacatcccggtcgaaatgatcgacggcgag
gaggctcggcggcgcgaaccgtacctcgcacgcgacgtggagaaggcgatcgcgctgccg
gacgccgcggtcgaccccttccgtctctgcgtcgccaacgcggccgacgcccgcgagcac
ggcgcccggatcgagactcacgcgccggtgaccgacgtgctcgtcgaggacggtgagatc
gtcggcgttgagatcgaacacgagacgggccccggcaagcgcgtccaccgcgagccgggg
acgaccgaggagatccgcgcgcgccacgtcgtcaacgcgaccggcgcgtgggcgggcaac
gtcggcgagatggccggcgtcgacgtggaagtgcgcccctcgaagggcgtgatgacggtg
atgaacacccggcaggtcgacaccgtcatcaaccgctgtcgaccgaagggcgacgccgac
atcatcgtcccccacgagaccgcctgcatcctcggcaccacggacgaggaggtcgacgac
cccgaagactaccccgaagaggagtgggaggtcgacctcatgatcgagacgctctcggaa
ctagtcccgatgctgaaagacgctcgaacgctccgctcgttctggggcgtccgtcccctc
tacgagccccccggaaccggtaccgaggacccgacggacatcacgcgcgactacttcttg
ctcgaccacggcgaccgcgacgacctccccgggatgaccaccatcgtcggcgggaagctt
accacctaccgcatgatggccgagtccatctcggaccacgtctgcgacgcgctcggccac
gacgcgacctgcgacaccgccgacgcgccgctgccggggtcggagaaccccgcgcgcatg
gacgagctgatggaggagttcgggctccgatccccggtggcccgccggtccggccagcgg
ctcggatcgcgcgccgccgacgtgctcgacgagtacgacccgaacccggtcgtctgcgag
tgcgagggcgtcactcgcgccgaggtgcaggacgcgatcggcgaggccggcagcgacctc
aacgcggtccgcattcgcactcgcgcctcgatggggaactgtcagggcggattctgtacc
caccgcatcgccgcagaactggcacaggagtacccggaacccgtcgtccgcgacgcggaa
gacgagctgtaccaggagcgctggaagggccagcggcacgcgctgtgggggatgcagctc
tcgcaggcgatgttgaaccacctgctgcacgcgacgacgatgaaccgcgacggcgacccg
gcgagcctcaacagcgaggtcgacttcggcgcgttcgacgcgggcgagggagggtccgag
gcggacgctatcgatggcggcgatgccggaaccgcggccacagacggagggatcgatggc
gatcgatag

DBGET integrated database retrieval system