KEGG   Halorubrum lacusprofundi: Hlac_1547
Entry
Hlac_1547         CDS       T00856                                 

Name
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
Organism
hla  Halorubrum lacusprofundi
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2
Other DBs
NCBI-ProteinID: ACM57135
UniProt: B9LP47
LinkDB
Position
1:1568041..1568988
AA seq 315 aa
MSDPDIVVLRQTIHGSGGAELAAAIRERLSDRSVALARTPAEERELLETARIAVGLDIDE
GQLAAAENLELFACVFAGTGHLPRDALADHGVALTNASGVHGPNIAEHVLGSMITHARQW
ARAHRQQERREWRSYETTEMYGSTVAVVGLGAIGSAIVDRLEPFDVDTVGVRYSPEKGGP
TDEVYGFDAFHDAIADAEYVVLACPLTETTRGLVDAEALRTMRADAILINIARGPIVDTD
ALVSELRNNRIRGAALDVTDPEPLPEDHPLWGLGNVTITPHNAGHTPHYYERVADILAEN
VGRLDDGDDLKNRVL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagcgacccagatatcgtcgtgttgcgacagacgatccacggctcgggcggcgcggag
ctggccgcggcgatccgcgagcgactctccgaccgatctgttgcgctggcgcggacgcca
gccgaggagcgcgagctgctcgaaacagcccggatcgccgtcgggctcgatatcgacgag
gggcagttggccgccgccgagaacctagagctgttcgcgtgcgtattcgccgggaccggc
cacctcccccgagacgcgctcgcggaccacggcgtcgccctgacgaacgcctccggggtc
cacggaccgaacatcgccgaacacgttcttgggtcgatgatcacgcacgcccggcagtgg
gcgcgcgcgcaccgccagcaggagcgccgggagtggcggagctacgagacgaccgagatg
tacggctcgaccgtcgccgttgtcgggctcggcgcgatcggctcggccatcgtcgaccgg
ctggagccgttcgacgtggacacggtcggcgtccggtactcgcccgagaagggcggcccg
accgacgaggtgtacgggttcgacgcgttccacgacgcgatcgcggacgccgagtacgtg
gtgctcgcgtgcccgctcacggagacgacccgcgggctcgtcgacgccgaggcgctccgg
acgatgcgggccgatgcgatcctcatcaacatcgcgcgcggaccgatcgtcgacaccgac
gcactcgtctccgaactccggaacaaccgcatccgcggggccgcactcgacgtgaccgac
cccgaaccactgcccgaagaccacccgctgtgggggctcggtaacgtcacgatcaccccg
cacaacgccggccacacgccccactactacgagcgcgtcgccgacatcctcgcggagaac
gtcggtcggctcgacgacggcgacgacctgaaaaaccgggtcctgtga

DBGET integrated database retrieval system