KEGG   Halorubrum lacusprofundi: Hlac_1580
Entry
Hlac_1580         CDS       T00856                                 
Name
(GenBank) aminotransferase class I and II
Organism
hla  Halorubrum lacusprofundi
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C DegT_DnrJ_EryC1 Beta_elim_lyase
Other DBs
NCBI-ProteinID: ACM57166
UniProt: B9LP78
LinkDB
Position
1:complement(1600152..1601300)
AA seq 382 aa
MRIDPFGLERWFAEYEHEADIMLAESGIRSLDASRFDLDPGRLDYVIPTNGDPDFRDSVG
KRYGRSADEVLFTCGTQEANFLTFLSLLGDAEGLEVDSSTDSTVGSGSHAVVVTPTYQAL
HAVPEAFGDVTRVELEPPEWELDPDTIADAARDDTAVIVVNNPNNPTGRYHDEAAMRAVY
DVAVDHDAYLLSDEVYRLLAEEPQPPVASFGAHGISTTSLTKAYGLAGLRFGWIAGPEAV
VERARRWKDYTTISPSLFGQHVAKQALGRREPRILEENRELAETNRAIVADWLDRHDLDW
YDPVGVNGFVTVPDGFDDAEAFCRAVVETESVVLAPGGLFGFPDRFRIGFGLPTAELEEG
LQRVSRVIEGESASEVDAEGGA
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcgcatcgacccgttcggcctcgaacgctggttcgccgagtacgaacacgaggccgac
atcatgttggccgaaagcgggatccggtcactggacgcgagccggttcgacctcgatccg
ggccggctcgactacgtcatcccgacgaacggcgaccccgacttccgtgactcggtcggc
aagcggtacggccggagcgccgacgaggtgctgttcacctgcgggacgcaggaggcgaac
ttccttacgttcctctcgctgctcggggacgccgagggactcgaagtcgactcgtcgacc
gactcgacggtcggctccggcagccacgccgtcgtcgtcacgcccacgtaccaagcgctc
cacgcggtccccgaggcgttcggcgacgtgacccgcgtcgaactagagccgccggagtgg
gagctcgaccccgacacgatagccgacgccgcccgcgacgacaccgccgtgatcgtcgtg
aacaacccgaacaaccccaccggtcggtaccacgacgaggcggcgatgcgggcggtctac
gacgtggccgtcgaccacgacgcgtacctcctctcggacgaggtgtaccgcctgctcgcc
gaggagccgcagccgccggtcgcgagcttcggggcccacggaatttcgacgacgagtctc
accaaagcgtacgggctcgccgggctccgattcggctggatcgccggccccgaggcggtc
gtcgagcgcgcgcggcggtggaaggactacaccaccatctcgccgagcctgttcggccag
cacgtcgcgaagcaggccctcggtcggcgcgagccgcgcatcttagaggagaaccgcgag
ctggcggaaacgaaccgcgctatcgtcgccgactggctcgatcgccacgacctcgactgg
tacgacccggtcggcgtcaacgggttcgtcacggtgcccgatgggttcgacgacgccgag
gcgttctgccgggccgtcgtcgagacggagagcgtcgtgctcgcgcccggcgggctgttc
ggcttcccggaccgcttccggatcgggttcgggctcccgaccgcagagttggaggagggc
ctgcagcgggtgagtcgcgtcatcgagggagagagcgcgagcgaggtcgacgcggaagga
ggtgcttaa

DBGET integrated database retrieval system