KEGG   Halorubrum lacusprofundi: Hlac_1611
Entry
Hlac_1611         CDS       T00856                                 

Definition
(GenBank) glycine cleavage system P-protein
  KO
K00282  glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00260  Glycine, serine and threonine metabolism
hla00630  Glyoxylate and dicarboxylate metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hlac_1611
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_1611
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Hlac_1611
SSDB
Motif
Pfam: GDC-P
Other DBs
NCBI-ProteinID: ACM57196
UniProt: B9LPA8
LinkDB
Position
1:complement(1630737..1632065)
AA seq 442 aa
MSGTSGTPYAPHTDAETSAMLSAIGVDDEEALFDIPNAVAFDGDFGIESRSEREIRAECS
QIFARNDDIVEFLGRGHYGHYVPSVVDHLADRAEFLTSYTQYQPEISQGFLQALFEYQSM
LVELTGLPIANCSMYDAATALGEAATLADRVRSTSGDAVLVPEHLREGKRAVLENYCAGA
DLTVESYPMADGNADVDALADRAGDDVVMVYAENPTVRGCIEERLATIGGLAADADALFT
LGSDPVSLSVLQEPASVGADVVVGEAGALGLPTAYGMGLGIFACSDEFLRQVPGRLVGAG
EDAAGDRAFTLTLQTREQHIRKERATSNICTNQAWVALRAAIHAATLGPDGLVDLANDCV
GEAAALADRIDDLSGAAAPVHDRHHVREFAVRVDQPAAAIAGDLETEGFAVHAIDEHLLQ
VCVTDLNADRTDGLVAAFEEVI
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgagcgggactagcggcacgccgtacgcgccccataccgatgccgagacatcggcgatg
ctctcggcgatcggtgtcgacgacgaggaggcgctgttcgacatcccgaacgccgtcgcg
ttcgacggtgatttcgggatcgagtcgcgctcggagcgcgagatccgcgcggagtgttcg
caaatattcgcgcgcaacgacgacatcgtcgagttcctcgggcggggccactacggccac
tacgtgccgagcgtcgtcgaccacctcgcggaccgcgccgagttcctcacgagctacacc
cagtaccagccggagatctcacagggattcttgcaggcgctgttcgagtaccagtcgatg
ctcgtggagctcaccgggctcccgatcgcgaactgctcgatgtacgacgccgccactgcg
ctcggtgaggcggcaacactggccgatcgcgtccgctcaacgtccggcgacgcggtcctc
gtccccgaacacctccgcgaggggaagcgcgcggtgctcgaaaactactgtgcgggtgct
gacctgaccgtcgagtcgtacccgatggccgacgggaacgccgatgtcgacgcgctcgcc
gaccgcgccggcgacgacgtggtcatggtgtacgccgagaaccccaccgttcgcggttgt
attgaggagcgactggccacgatcggtggcctcgcggccgacgccgacgcgctgttcacg
ctcgggtcggacccggtttcgctgtcggtgctccaagagccggcgagcgtcggcgccgac
gtggtcgtcggtgaggcgggcgcgctcgggctcccgaccgcctacgggatggggctcgga
atcttcgcctgcagcgacgagttcctccggcaggtgccggggcggctcgtcggcgccggc
gaggacgccgcgggcgaccgcgcgttcacgctcacgctccagacgcgtgaacagcacatc
cggaaggagcgtgcgacctcgaacatctgcacgaatcaggcgtgggtcgcgctccgcgcc
gcgatccacgcggcgacgctcggccccgacgggctcgtcgacctcgcgaacgactgcgtg
ggggaggcggccgcgctcgccgaccggatcgacgatctcagcggcgcggccgcaccggtc
cacgaccgccaccacgtccgggagttcgccgtgcgcgtcgaccagcccgcggcagctatc
gcgggagacttagagaccgaggggttcgcggtccacgcgatcgacgaacacctgctgcag
gtgtgtgtcaccgacctgaacgcggatcgaaccgacggtctcgtcgccgctttcgaggag
gtgatctga

DBGET integrated database retrieval system