KEGG   Halorubrum lacusprofundi: Hlac_1622
Entry
Hlac_1622         CDS       T00856                                 

Name
(GenBank) Mandelate racemase/muconate lactonizing protein
  KO
K19802  L-Ala-D/L-Glu epimerase [EC:5.1.1.20]
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hlac_1622
Enzymes [BR:hla01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.20  L-Ala-D/L-Glu epimerase
     Hlac_1622
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Trypco2
Other DBs
NCBI-ProteinID: ACM57207
UniProt: B9LPB9
LinkDB
Position
1:complement(1642325..1643374)
AA seq 349 aa
MTLETEFERVSLPLENPFTIFRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTV
EAVLPDLLDAVERVGDPHALHEIEAELAAVVNGNPAARAAVSIAVHDLAAKRLGVPLHRL
WGLDPTAAPATSYTIGLDETERVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPD
ARLRVDANEAWTPREAVRKCEWLADRDVEFVEQPVPAEDPEGLRFVYERSALPVAADESC
VTLSDIPAIADRCDIANLKLMKTGGLLEAKRMIAAARAHGLEVMCGCMIESNASIAAAAQ
LAPLLDYADLDGSLLLAEDQYDGIEMGGGEIRLGDQERAGTGARPSAEQ
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaccctcgaaacggagttcgagcgggtctcgcttcccttggagaacccgttcacgatc
ttcaggggcacccagacggacgccgagaacgtgatcgtgaagatcgcggacgaggccgga
atgaccggcgtcggcggcgcggctccctcggctcactacggcgagaccgcggacaccgtc
gaggccgtgctcccggatctgctcgacgccgtcgagcgcgtcggcgacccccacgcgctc
cacgagatcgaggccgaactggcggccgtcgtcaacggcaaccccgccgcccgcgccgcc
gtctcgatcgcggtccacgacctcgccgcgaagcggctcggcgtccccctccaccgtctc
tgggggctcgaccccacggccgcgcccgcgacctcctacacgatcggactcgacgagacg
gagcgcgtccgtgagaaggccgaggccgcggtcgatgccggctacccgatcctcaagatc
aagctcgggaccgaccgagaccgcgagctgatcgacgcggtccgcgaggccgcgcccgac
gcccggctccgggtcgacgcgaacgaggcgtggacgccccgcgaggcggtccggaagtgc
gagtggctcgccgatcgcgacgtggaattcgtcgagcaaccggtgcccgccgaggacccg
gaggggctccggttcgtctacgagcggtcggcgctccccgtcgccgccgacgagtcctgc
gtgacgctctccgacatccccgcgatcgccgaccggtgtgacatcgcgaacctgaagctg
atgaagaccggcggcctgctggaggcgaaacggatgatcgccgccgcgcgcgctcacggg
ctggaagtgatgtgcggctgcatgatcgagtcgaacgcctcgatcgctgcggccgcgcag
ctcgcgcccctactcgactacgccgacctcgacgggtcgctgctgctcgccgaggaccag
tacgacgggatcgaaatgggaggcggcgagatccggctcggggaccaggagcgggcgggg
accggcgcccgcccgagcgcggagcagtag

DBGET integrated database retrieval system