KEGG   Halorubrum lacusprofundi: Hlac_1625
Entry
Hlac_1625         CDS       T00856                                 

Name
(GenBank) aldo/keto reductase
  KO
K06222  2,5-diketo-D-gluconate reductase B [EC:1.1.1.346]
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hlac_1625
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.346  2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming)
     Hlac_1625
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-ProteinID: ACM57210
UniProt: B9LPC2
LinkDB
Position
1:complement(1645604..1646380)
AA seq 258 aa
MHLPSVGLGTMGIDDPEPVATALSLGYRHLDTARIYGNEAVVGDGLAEGLAASDVDRDEV
TVATKLWVDDLGAADVGPTARESADLLGVETLDLLYVHRPRGAYDPVETLPALDRLVDEE
VVREVGVSNFEVDQLDRAIDTLDAPLAAHQTELHPLFYRPELLEHAREHGYTVVAYSPLA
GGRVSEIDAVVEVAEAHDATPEAVAIAWATAKEPVVTIPKASSEGHLRANLAAAEIELTP
EEVAAIDAVEREEELFPE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaccttccgtccgtcggcctcggaacgatgggaatcgacgacccggagccggtcgcg
accgcactctcgctcggctaccgccacctcgacaccgcccggatctacggcaacgaggcg
gtcgtcggtgacgggctcgccgaggggcttgccgcgagcgacgtggaccgggacgaggtc
acggtcgccacgaagctgtgggtcgacgacctcggcgccgccgacgtgggtccgaccgcc
cgcgagagcgccgacctgctcggcgtggagacgctcgatctcctgtacgtccaccgccca
cggggagcgtacgacccggtggagaccctccccgcgctcgaccggctcgtcgacgaggag
gtcgtgcgcgaggtcggcgtctccaacttcgaggtcgaccagctcgaccgcgcgatcgac
accctcgacgcgccgctcgcggcccaccagacggagctacaccccctgttctaccggccg
gaacttctggagcacgcccgcgagcacgggtacacggtcgtcgcctactcgccgttggcg
ggcggtcgagtgagcgagatcgacgccgtggtcgaggtcgcagaggcccacgacgcgacg
cccgaggcggtcgcgatcgcgtgggcgaccgcgaaagaaccggtcgtgacgatcccgaag
gcgtcgagcgagggtcacctccgcgcgaacttggcggccgccgagatcgagttaacgccc
gaggaggtcgccgccatcgacgccgtcgaacgcgaggaggagctgtttccggagtag

DBGET integrated database retrieval system