KEGG   Halorubrum lacusprofundi: Hlac_1628
Entry
Hlac_1628         CDS       T00856                                 
Name
(GenBank) peptidase S8 and S53 subtilisin kexin sedolisin
Organism
hla  Halorubrum lacusprofundi
SSDB
Motif
Pfam: Peptidase_S8 CarboxypepD_reg CarbopepD_reg_2 CARDB PEGA DUF4832 MetallophosN phage_tail_N Big_6 PGF-CTERM
Other DBs
NCBI-ProteinID: ACM57213
UniProt: B9LPC5
LinkDB
Position
1:complement(1648534..1652181)
AA seq 1215 aa
MIPSSPFSTATAATLVLVACLIVAAVAPGAVAGGLVTSSTEAVDSGRTDPAAVGSVSTAD
GDVIASDLRSANGTVKLVVRFAGGTRIGTDDGEVGYSKGSSTLSTNDLKTNAASAQADFE
SFAEGRSAVTVERSFWLANAMLVTVDTDRVPLDRLVDVPGVEGVHENFEVELDSATTTTP
GDGGSQAIGTSGLPPAPTPEDVSTASTDTDATYGVEMVRAPEVWETFGTRGKGATVAVID
TGIDPDHPDLTVSGWAEYDADGNLVSDDVSDASDGDGHGTHVAGTVAGGNASGTAIGVAP
NASLHGIKVFDDDGTNATFVRVVAGMEHATQDPDVDVLQMSLGADGHLPYFIEPVRNTRS
AGKIAVVSAGNIGQGTSSSPGNVYDSLAVGAVNDSRGVADFSSGETINTSSAWGSDAPAD
WPDEYVVPDVSAPGVSVYSAEPGGTYIRKDGTSMAAPHVSGVAALMLSASSGDVSDDKLY
DTLRNTANHPSNAADPDDRYGAGIVDGFEAVSSVTSDEFTVTEFDGPKETDPGATVEASA
TVTNTGGGPGTGTVEYQFNGTVGNDTTVSLDPGEATTVSFTYVVPHETDPDEYSHGVYTE
DSSQASTITVREPPSYTVTDLTTPETVERGGPLTTTVNVTNDGEVAGDNRTVELRLVDPG
NASNASALGAENVSLGPGNTTTVSLSGTVPSGFGTGETTVTVVSPEDDASASIRIAEAVG
TISGTVTDAETNASLAEIDVVVKNGTEVVGTTITGSEGTYAIDVPATDLTVIASNATYAP
ADQTVALAGSGDTATANISLALRNGTLSGVVGASDGLDLPSNATVTVTDETGGAVAAVDA
ASDGTYSVDLRPGTYNATADAPDFDTQTVADIAVSPNATASESFALIPQRGSLSGMVTNA
TDSEAIPDATITVDGERTATTDANGTYALDALERGEREITVSADGYAQKSQTLTFTANDT
RELNVSLSPRGAFVITQLSGDDEIEQGSSGGFGLTVRNDGRVTDDASVDVTLNRSGSVSP
NPVVIGDVAVGDTESESVSVSLGSSAATGTYAVTATTPDSEKTLTFVAVSSDDAESDGGG
TAGGGGGTAGAGPAPPPSTEDPDEPENATDDPTNETDDPTNATDDPTNATDDPTDGEDDP
VDGELADGDDENNAEDDGIDTESGVATDGESGGDDTSDEDESADGTPGFGPAIGVLAIFG
AAFLVGRRGGRGGRE
NT seq 3648 nt   +upstreamnt  +downstreamnt
gtgatcccctcgtctcccttttctaccgcgactgccgccacgctcgttcttgtcgcctgt
ctgatcgtggccgccgtcgcacccggtgcggtcgctggcggtttggttacgagcagcact
gaggcggttgattccggcagaaccgatcccgccgcggtcggttccgtttcgacggccgac
ggcgatgtgatcgcctccgacctgcgctcggcgaacggcaccgtcaagctcgtggtgcgg
ttcgcgggcggcactcggatcggaaccgatgacggcgaagtggggtattcgaaggggtcg
tcgacgctctcgacgaacgacctcaaaacgaacgccgcgagcgcgcaggccgacttcgaa
tcgttcgctgagggacggtccgcggtcacggtcgaacgaagcttctggctcgcgaacgcg
atgctcgtcacggtcgacaccgaccgcgtcccgctggatcggctcgttgatgtgccgggc
gtcgagggcgtccacgagaacttcgaagtcgaactcgactcggcaacaacgacgactccc
ggcgacggtggttcgcaggcgatcgggacctccggtctaccgcccgcgcctactcccgag
gacgtctcgaccgcttcgaccgacaccgacgccacctacggcgtcgagatggtgcgcgcg
ccggaggtctgggagacgttcgggacccgcgggaagggcgcgaccgtcgccgtgatcgac
acgggaattgacccggaccatcctgacctaacggtgagcgggtgggcggagtacgacgcg
gacgggaatctggtgagcgacgacgtgtccgatgcgtcggacggagacgggcacggaact
cacgtcgccggaaccgtcgcgggcggaaacgcgagtgggaccgcaatcggcgtcgcaccg
aacgcgtcgctccacgggatcaaggtgttcgacgacgacgggaccaacgcgacgttcgtc
cgcgtcgtcgcgggaatggaacacgcgacgcaggatccggacgtcgacgtgcttcagatg
agcctcggtgcggacgggcacttaccatacttcatcgaaccggttcggaacactcgcagt
gccgggaagatcgcggtcgtttcggccgggaacatcggtcaaggaacgtcgagttctccc
gggaacgtctacgactcgctcgcggtcggagcggtcaacgacagccgcggcgtcgccgac
ttctccagcggagagacgatcaacacgtcaagcgcgtggggaagtgatgcccccgcggac
tggcccgacgagtacgtggttccggacgtgtcggcgccaggcgtgagcgtatactcggcg
gaaccgggcggtacctacatccgaaaggacggcacctccatggccgcaccgcacgtcagc
ggcgtcgcggcgttgatgctgtcggcgtcgtcgggcgatgtttctgacgacaagctctac
gacacgctccgtaataccgcgaaccacccgtcgaacgcggccgatcccgacgaccgctac
ggggccggaattgtggacggattcgaagccgtctcttcggtcacgagcgacgagttcacg
gtgactgagtttgatggccccaaagaaacggaccccggtgcgacggttgaagcctccgca
acggtcaccaacactggtggcggaccgggaaccggaactgtcgagtaccaatttaacgga
accgtcggtaacgacacaaccgtctctctcgatcccggcgaagcgacgaccgtctcgttc
acctacgtcgtcccccatgagaccgatccggacgaatactcgcacggcgtctacactgag
gattcgagtcaagcgtcgacaattactgtccgtgaacctccctcgtacacggttacggat
ctcaccacgcccgaaaccgtcgaacgcggtggaccgcttaccaccacggtgaacgtgacg
aacgacggcgaggtggccggcgataaccgcaccgtcgaactccgcctcgtcgaccccggg
aatgcgagcaacgccagcgccctcggcgcggagaacgtctcgctcggccccggaaacacg
acgacggtttcgctcagcggaaccgtgccgagcgggttcgggaccggcgagacgaccgtg
acggtcgtctcccccgaggacgacgcctcggcgtcgatccggatcgcggaggccgtcggg
acgatcagcggtaccgtcaccgacgcggagacgaacgcgtccctcgccgagatcgacgtg
gttgtgaagaacggtacagaagtggtaggaacgacgataacgggatctgagggcacctac
gcgatcgacgttccggctacggatctcaccgtcatcgcgagcaacgcgacgtacgccccg
gcggatcagacggtggccctggccgggtcgggggacaccgcgaccgcgaacatctcgctc
gcgctccggaacggcacgctgagcggcgtcgttggcgcgagtgacggactcgatctcccg
tcgaacgcgaccgtgacggtcacggacgagacgggcggagcggtcgcggccgtcgacgcg
gccagcgacgggacctattccgtcgatctccgtcccggcacctacaacgccaccgcggac
gcgccggacttcgatacccagacggtagccgacatcgcggtttcgccgaacgcgacggca
agcgagagcttcgcactaatcccacagcgagggtctctctccgggatggtgacgaacgcg
accgacagcgaggcgatcccggacgcgacgatcacggtagacggggaacggacggccacg
accgacgcgaacggaacctacgcgctcgacgctctcgaacgcggcgagcgggagataact
gtctccgcggacggatacgcacagaagagtcagacgctcacgttcaccgcgaacgacact
cgagagctgaacgtctcgctgtctcctcgtggcgcgttcgttatcacccaactctcggga
gatgacgaaatcgaacagggatcgagcggcggcttcgggctcacagtgcgaaacgacggg
cgcgttaccgacgacgcgtccgtggacgtcacgctgaatcggagcggctccgtgagtccc
aatcccgtggtgatcggcgacgttgcggtcggcgataccgagtcggaatcggtctctgtg
tcgctcggatcgagtgcagcgaccgggacatacgccgtaaccgccacgactcccgacagc
gaaaagacactcacgttcgttgcagtcagcagcgatgacgccgaatccgacggcggcggc
acagcaggcggtggcggcggcacagcaggcgccggtcccgcgccaccgccgagcacggag
gaccctgacgagcccgaaaacgcgaccgacgatccaacgaacgagaccgacgacccgacg
aacgcgaccgacgacccgacgaacgcgaccgacgacccgacagacggcgaagacgatccg
gtcgacggtgagttagcggacggcgatgatgagaacaacgcggaagacgacgggatcgat
accgaatctggcgtggcgaccgacggggagtccggaggcgacgacaccagcgacgaagac
gagtcggccgacggaacgcccggcttcggtcccgcgatcggcgtcctcgcgattttcggg
gcggcgttcctcgtcgggcggcgcgggggacgcggcggtcgcgagtaa

DBGET integrated database retrieval system