KEGG   Halorubrum lacusprofundi: Hlac_1650
Entry
Hlac_1650         CDS       T00856                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hla  Halorubrum lacusprofundi
Brite
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Hlac_1650
SSDB
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Other DBs
NCBI-ProteinID: ACM57235
UniProt: B9LPE7
LinkDB
Position
1:complement(1671557..1672156)
AA seq 199 aa
MSYELDPLPYDYDALEPHLSEQVLEWHHDTHHQGYVNGWNSAEETLEANREEHDFSSSGG
AIRNVTHNSSGHILHDLFWQNMSPEGGDEPDGALADRIAEDFGSYDAWKGEFEAAASAAS
GWALLVYDTFSNQLRNVVVDKHDQGAIWGGHPILALDVWEHSYYHDYGPARGEFVDNFFE
VVDWNEPATRYEQAVELFE
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagctacgaacttgatccgctgccgtacgattacgacgcgttggaaccgcacctttcg
gagcaggtgctggaatggcatcacgacacgcaccatcaagggtacgtgaacgggtggaac
tcggccgaggagacgctcgaagcgaaccgcgaagagcacgacttctcgtcgtcgggcggg
gcgatccggaacgtgacccacaactcgtcgggtcacatcctgcacgacctgttctggcag
aacatgagcccggagggcggcgacgagcccgatggcgcgctggccgaccggatcgcggag
gacttcggctcgtacgacgcctggaagggcgagttcgaggcggcggcgtccgccgcgtcc
ggctgggcgctcttagtgtacgacacattctcgaaccagctgcggaacgtcgtggtcgac
aagcacgaccagggcgcgatctggggcggtcacccgattctggcgctggacgtgtgggag
cactcctactaccacgactacggcccggctcgtggcgagttcgtcgacaacttcttcgag
gtcgtcgactggaacgagcccgcgacccgctacgagcaggccgtcgagctgttcgagtaa

DBGET integrated database retrieval system