KEGG   Halorubrum lacusprofundi: Hlac_1702
Entry
Hlac_1702         CDS       T00856                                 

Definition
(GenBank) putative circadian clock protein, KaiC
  KO
K08482  circadian clock protein KaiC
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Hlac_1702
SSDB
Motif
Pfam: ATPase AAA_25 Rad51 RecA DnaB_C AAA_22 AAA_16 AAA_14 DUF2075 AAA_24 IstB_IS21 NACHT ATPase_2 ResIII MEDS CbiA PAXNEB TrwB_AAD_bind ABC_tran AAA_7 T2SSE RNA_helicase AAA_33 AAA_30 TsaE cobW AAA NB-ARC AAA_18 Roc AAA_29 RsgA_GTPase P-loop_TraG GvpD Herpes_TK ATP-synt_ab Tail_tube
Other DBs
NCBI-ProteinID: ACM57287
UniProt: B9LPJ9
LinkDB
Position
1:complement(1720816..1722315)
AA seq 499 aa
MSTPLAGRASTGIRGLDEVLSGGLVPERSYMVRGQAGSGKTILSFHFLQQGVDEGETVLF
INLEEDLRDLKANAAALGFDTDAIEFLDLSPSADVFVEDDSYEVFAPAEVEREPLTDKIV
AGVTAVDPDRVVVDPLTQLRFLLSDDYQFRKQVVGFMRFLKDREATVLFTVQNTESLPTD
DLEFITDGTIRLDAAEYGKTVRVPKFRGSATQSGEHAYRVTDSGIEVYPALQPGKRDEDA
TFEQISSGIPEFDELLHGGIERGTVTVVSGPTGVGKTTLSTQFMKEAAGRGERSVIYLFE
ENKGTFLTRSRAVNIPVDEMMEKGTLQVNEVEALERSPQEFGRMVREEVEERGADIVMID
GIAGYRLTLRGEEGMMLQQMHALGRYLKNAGVTAIFVDETRNVTGEFQATMENISYLADN
IVFLRHLEVHGEMRKAIGVLKKRTSDFERTIREFQITSHGLKVGEPMSGMRGILSGTPEV
VDDDRERQRRGVDRESEDC
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtcaacaccacttgccggtcgcgcttcgaccggcatccggggactcgacgaagttctg
tcgggggggctcgtcccggagcggagctacatggtccgcggtcaggccggcagcggaaag
acgatcctgagcttccatttcctccagcagggcgtcgacgagggggagacggtgctcttc
atcaacctcgaggaggatctccgcgacctgaaggcgaacgcggcggcgctcggcttcgac
accgacgccatcgagttcctcgatctcagcccgagcgcggacgtgttcgtcgaggacgac
tcgtacgaggtgttcgcgcccgccgaggtcgagcgggagccgctgaccgacaagatcgtc
gcgggcgtgaccgcggtcgaccccgaccgcgtcgtcgtcgacccgctgacccagctccgc
ttcctgttgtccgacgactaccagttccggaagcaggtggtcgggttcatgcgcttcctg
aaagaccgggaggcgacggtgctcttcaccgtccagaacaccgaatcgctgccgacggac
gatctcgagttcatcacggacgggacgatccggctggacgcggcggagtacggcaagacg
gtccgcgtcccgaagttccgcggatcggcgacccagagcggggagcacgcctaccgggtc
accgactcgggcatcgaggtgtaccccgcgctccagcccggaaagcgcgacgaggacgcc
acgttcgagcagatctcctcggggatcccggagttcgacgagctgctccacggcgggatc
gaacgggggaccgtcacggtcgtgagcgggccgaccggcgtggggaagacaaccctgagc
acccagttcatgaaggaggccgcgggtcggggggaacgctccgtcatctatctcttcgag
gagaacaaggggacgttcctcactcggtcgcgcgcggtaaacatcccggtggacgagatg
atggagaaagggaccctccaggtgaacgaggtggaggcgttagagcggtccccacaggag
ttcgggcggatggtccgcgaggaggtcgaagagcgcggcgcggacatcgtcatgatcgac
gggatcgccgggtaccggctgacgctgcgcggcgaggaggggatgatgctccagcagatg
cacgcgctcggccgatatctcaagaacgcgggcgtgacggcgatcttcgtcgacgagacg
cggaacgtcacgggagagtttcaggcgacgatggagaacatcagctacctcgcggacaac
atcgtcttcctccgccacctggaggttcacggcgagatgcggaaggcgatcggcgtgttg
aaaaagcgaacgagcgacttcgagcggaccatccgcgagttccagatcaccagccacggg
ctcaaggtcggcgagccgatgtcggggatgcgaggaattctgagcggcacgcccgaggtc
gtcgacgacgaccgggagcgccagcgccgcggtgtcgaccgcgagagcgaggactgctga

DBGET integrated database retrieval system