KEGG   Halorubrum lacusprofundi: Hlac_1716
Entry
Hlac_1716         CDS       T00856                                 

Definition
(GenBank) AAA family ATPase, CDC48 subfamily
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hla03019]
    Hlac_1716
   04131 Membrane trafficking [BR:hla04131]
    Hlac_1716
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hla04147]
    Hlac_1716
Messenger RNA biogenesis [BR:hla03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     Hlac_1716
Membrane trafficking [BR:hla04131]
 SNARE
  SNARE associated proteins
   Others
    Hlac_1716
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Hlac_1716
Exosome [BR:hla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Hlac_1716
SSDB
Motif
Pfam: AAA CDC48_N AAA_lid_3 CDC48_2 RuvB_N AAA_5 AAA_16 AAA_2 AAA_22 TIP49 AAA_33 AAA_14 IstB_IS21 AAA_18 Sigma54_activat RNA_helicase AAA_7 Mg_chelatase ATPase AAA_28 AAA_3 ABC_tran Vps4_C AAA_24 TsaE DUF815 PhoH AAA_11 NB-ARC AAA_17 NACHT DUF2075 AAA_30 Parvo_NS1 Zeta_toxin IPT
Other DBs
NCBI-ProteinID: ACM57299
UniProt: B9LPL1
LinkDB
Position
1:1730790..1733012
AA seq 740 aa
MNEVQLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWN
TDTVRVDGFTRQNADVGIGERVTIRKAEAEKAEKLVLAPPEEASVQFGSDAAGMVKRQIL
KRPVVERDIVPVMSSTNHPFMRSPGQAIPLIAVDTEPDGVCLITEDTEVELREEPISGFE
KTGSGITYEDIGGLQSEIQRVREMVELPMKHPQIFSKLGIEPPQGVLLHGPPGTGKTLLA
KAVANETSASFFSIAGPEIISKYYGESEQQLREIFEDAKEESPSIIFIDELDSIAPKRED
VTGEVERRVVAQLLTMMDGLETRGQVVVIGATNRVDSVDPALRRPGRFDREIEIGVPDEV
GRKEILQIHTRGMPLSDDVSLDHLADETHGFVGADIESLTKEAAMKALRRYLPEIDLDDE
EVPPSLIDRMIVKRDDFGAALNEVEPSAMREVLVELPKISWDDVGGLSEAQQQVQESVEW
PLSSPEKFDRMGVDPPKGVLLYGPPGTGKTLMAKAVANETNANFISVRGPQLLSKWVGES
EKAIRQTFRKARQVSPTIIFFDELDSLAPSRGQEMGNNVSERVVNQLLTELDGLEEMGDV
MVIGATNRPDMIDPALLRSGRFDRLVMIGQPDQEGRERILEIHTQDTPLAPDVTLREIAE
ITDGYVGSDLEGIAREAAIEALRDDDDAEEVEMKHFRRALESVRPTINDDILAYYEEVEE
QFKGGSGNAIRDTGGKIGFQ
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgaacgaagtccaactcgaagtggcgaaagcgtacccgaacgactcgggtcgcggcatc
gcccgactcgaccccgatacgctgttgcacctcaagctctcgcccggcgacatcatcgag
atcgagggcgcggagacgaccgccgccaaggtctggcgcgccgaccgccaggactggaac
acggacacggtccgcgtcgacggcttcacccgtcagaacgccgacgtgggcatcggcgag
cgcgtgacgatccggaaggcggaggccgaaaaagccgagaagctcgtcttggctccgccc
gaggaggcgtccgtccagttcggctccgacgccgctggcatggtgaaacgccagatcctc
aagcggccggtcgtcgagcgcgacatcgttcccgtgatgtcgtcgacgaaccacccgttc
atgcgatcgcccggacaggcgatcccgctaatcgcggtcgacaccgagcccgacggcgtc
tgtctgatcaccgaggacaccgaagtcgaactgcgcgaggagccgatctccgggttcgag
aagaccggcagcggtatcacctacgaggatatcggcgggctccagtcggagatccagcgc
gtccgcgagatggtcgagctgccgatgaaacacccgcagatcttctcgaagctcgggatc
gagccgccgcagggcgtcctcctgcacggcccgccgggcacggggaagaccctgctcgcg
aaggcggtcgccaacgagacgagcgcgtcgttcttctcgatcgccggcccggagatcatc
tcgaagtactacggcgagtccgaacagcagctccgagagatcttcgaggacgcgaaagag
gagagcccgagcatcatcttcatcgacgagctcgactcgatcgcgccgaagcgcgaggac
gtgaccggcgaggttgagcgccgcgtcgtcgcgcagctgttgacgatgatggacggcctc
gaaacgcgcggacaggtggtcgtcatcggcgcgacgaaccgcgtcgacagcgtcgatccc
gcactccggcgccccgggcgcttcgaccgcgagatagagatcggcgtccccgacgaggtg
ggtcgcaaggagatcctccagatccacacccgcgggatgccgctctcggacgacgtctct
ctcgatcacctcgccgacgagacgcacgggttcgtcggcgccgacatcgagagcctcacg
aaggaggccgcgatgaaggcgcttcggcggtacctccccgagatcgacttagacgacgag
gaggtcccgccgagcctcatcgaccggatgatcgtcaagcgcgacgacttcggtgccgcg
ttaaatgaggtggagccctccgcgatgcgcgaggtcctcgtcgagctcccgaagatatcg
tgggacgacgtcggtgggctcagtgaggcccaacagcaggttcaagaatccgtagagtgg
ccgctcagctcgccggagaagttcgaccggatgggcgtcgaccccccgaagggcgtgctg
ctgtacggcccgcccggcaccgggaagacgctgatggcgaaggcggtcgccaacgagacg
aacgcgaacttcatctcggtcagggggccacagctgctctcgaagtgggtcggcgagtcg
gagaaggcgatccggcagaccttccggaaggcccggcaggtgagcccgaccatcatcttc
ttcgacgagctggacagcctcgcgccttcgcgcgggcaggagatggggaacaacgtctcc
gagcgcgtcgtcaaccagctgctgacggagctcgacgggttagaggagatgggcgacgtg
atggtgatcggcgccaccaaccgtcccgacatgatcgaccccgcgctgctgcgctccggc
cggttcgaccggctcgtcatgatcggacagcccgaccaggagggccgcgagcggatcctc
gagatccacacgcaggacacgccgctcgcacccgacgtgaccctccgcgagatcgccgaa
atcaccgacggctacgtcggctccgatctggagggcatcgcccgcgaggccgccatcgag
gcgctgcgcgacgacgacgacgccgaggaggtcgagatgaagcacttccggcgcgcgctg
gagtcggtgcgccccacgatcaacgacgacatcctcgcgtactacgaggaggtcgaagag
cagttcaagggcggcagcggcaacgcgatccgcgacaccggcggcaagatcgggttccaa
taa

DBGET integrated database retrieval system