KEGG   Halorubrum lacusprofundi: Hlac_1940
Entry
Hlac_1940         CDS       T00856                                 

Definition
(GenBank) N-(5'phosphoribosyl)anthranilate isomerase (PRAI)
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01230  Biosynthesis of amino acids
Module
hla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hlac_1940
Enzymes [BR:hla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Hlac_1940
SSDB
Motif
Pfam: PRAI TMP-TENI BtpA
Other DBs
NCBI-ProteinID: ACM57518
UniProt: B9LQ97
LinkDB
Position
1:1940440..1941084
AA seq 214 aa
MARVKICGLTRGADLRAAIDAGADAVGVISEVPVDSPREVDPATAAELLADVPPFVTATL
VTMPDSAERAVELLRTICPDAIQLHGEWTPDEIRFIRAETERKVLLAVDADDPARAEEFD
RVADALVIDSTDDSGAGGTGETHDWERAGDLADRLTSPVVLAGGLTADNVAEAVRAADPF
AVDVASGVELTDGRKDHNAVARFVANAGREMELA
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcgcgggtgaagatctgcgggctgacgcggggagccgacctccgcgccgcgatcgac
gccggcgccgacgcggtgggcgtcatctccgaggtcccggtcgactccccccgcgaggtc
gacccggcgacggcggcggagctactcgcggatgtaccgccgttcgtcaccgcgacgctc
gtcacgatgcccgactccgccgagcgcgcggtcgagctcctacggacgatctgtccggac
gccatccagcttcacggcgagtggacgcccgacgagatccggttcatccgcgcggagacg
gagcggaaggtgttactcgcggtcgacgccgacgacccggcgcgggccgaggagttcgat
cgggtcgccgacgcgctcgtgatcgactcgaccgacgactccggcgcgggcggcaccggc
gagacccacgactgggaacgagccggcgacctcgccgaccgactcacctcgccggtggtc
ctcgccggcggactcacggccgacaacgtcgccgaagcggttcgcgccgccgatccgttc
gcggtcgacgtggcctcgggcgtcgaactcaccgacgggcgaaaggaccacaacgcggtg
gcccgcttcgtggcgaacgcggggcgggagatggagttggcatga

DBGET integrated database retrieval system