KEGG   Halorubrum lacusprofundi: Hlac_1941
Entry
Hlac_1941         CDS       T00856                                 
Name
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01230  Biosynthesis of amino acids
hla02024  Quorum sensing
Module
hla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hlac_1941
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Hlac_1941
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hlac_1941
Enzymes [BR:hla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Hlac_1941
SSDB
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Other DBs
NCBI-ProteinID: ACM57519
UniProt: B9LQ98
LinkDB
Position
1:1941081..1942745
AA seq 554 aa
MTESATPIDRSKAEFVDLAADAEKPAVVRASASLDADVTPLAAYATLVGEGPYGFLLESG
EKVASSDPDGAFTADGDVDKHARYSFVGYDPEAIVSVHPDRTDVTRLGPAAEFVGDESDG
DLGPDAGDAIDRIRAAFPDVSLRGFPDTDRQILSGGFVGFLAYEAVYDLWLEEVGVKRPE
TEFPDAEFALTTRTVVFDDKEGTVELVFTPIVGVDDDPATVYDDLVAEAERVGAELRDAS
PPTPDGIRVTDESADPREAYEEAVRTAKRHVLDGDIYQGVISRSRELRGEVDSLGLYAAL
REVNPSPYMYVLRHDDRSIVGASPETLVSVQGDRIVSNPIAGTCPRGESPVEDRRLAGEM
LADGKERAEHTMLVDLARNDVRRVSEPGSIRVEEFMNVLKYSHVQHIESTVTGTLAGDAD
AFDATRATFPAGTLTGAPKVRAMEIIEELETTPREAYGGGVGYYAWTGDADFAIVIRTAT
LDESPPDASGPDETAVTVRAGAGLVADSDPAAEYEETEQKMDGVLTAIDRIREGGDGDSL
SSDDTLPAGTEVDE
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaccgagtcggcgactccgatcgatcgctcgaaggccgagttcgtcgacctcgcggcc
gacgccgagaagccggccgtggtccgcgcgtccgcgtcgctcgacgccgacgtgaccccg
ctggcggcgtacgcgacgctggtcggcgagggtccgtacgggttcctcttggagtccggc
gagaaggtcgcctccagcgaccccgacggcgcgttcaccgccgacggcgacgtcgacaaa
cacgcccggtactcgttcgtcggctacgaccccgaggcgatcgtctcggtccacccggac
cggacggacgtgactcggctcggcccggcggcggagttcgtcggagacgagtctgacggc
gatctgggtcccgacgccggcgacgcgatcgatcgaatccgggcggcgttcccggacgtg
agcctgcgcggcttcccggataccgaccgacagatcctctcgggcggcttcgtcggcttc
ctcgcgtacgaggccgtctacgacctctggttggaggaggtcggcgtcaagcgccccgag
accgagttcccggacgccgagttcgcgctgacgacccggaccgtcgttttcgacgataag
gaggggaccgtcgaactcgttttcaccccgatcgtcggcgtcgacgacgaccccgcgacc
gtctacgacgacctcgtcgctgaggcggagcgggtcggcgccgagctccgggacgcgtcc
ccgccgacgcccgacgggatccgcgtgaccgacgagtccgccgacccccgagaggcgtac
gaggaggcggtgcggaccgccaaacggcacgtccttgacggcgatatttatcagggcgtg
atctcgcggagccgcgagctccgcggcgaggtcgactcgctcgggctgtacgcggcactg
cgcgaggtgaacccctcgccgtacatgtacgtgctgcgccacgacgaccgcagtatcgtc
ggcgcgagccccgagacgctggtgtcggtgcaaggcgaccgtatcgtctcgaacccgatc
gcgggcacctgtccccggggggagagcccggtcgaggaccgtcggctcgccggcgagatg
cttgcggacgggaaggagcgcgctgaacacacgatgctcgtcgacctcgcgcgcaacgac
gtgcggcgcgtctcggagccgggctcgatccgcgtcgaggagttcatgaacgtgttgaag
tacagtcacgtccagcacatcgagtcgaccgtgacggggacgctggcgggcgacgccgac
gccttcgacgcgacgcgcgcgacgttccccgcgggcacgctcaccggtgcgccgaaagtg
cgcgcgatggagatcatcgaggagttggagacgaccccgcgggaggcgtacggcggcggc
gtcggctactacgcgtggaccggcgacgccgacttcgccatcgtgatccggacggcgacg
ctcgacgagtcgccgccggacgcgagcggtccggacgagaccgcggtgaccgtccgcgcc
ggtgccgggctcgtcgccgactccgacccggccgccgagtacgaggagaccgaacagaag
atggacggcgtgttgaccgcgatcgaccggatccgggagggcggtgatggcgactccctc
tcctccgacgacaccctccccgccggcacggaggtcgacgaatga

DBGET integrated database retrieval system