KEGG   Halorubrum lacusprofundi: Hlac_1943
Entry
Hlac_1943         CDS       T00856                                 
Name
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03638  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00790  Folate biosynthesis
hla01100  Metabolic pathways
hla01240  Biosynthesis of cofactors
hla04122  Sulfur relay system
Module
hla_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hlac_1943
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Hlac_1943
Enzymes [BR:hla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     Hlac_1943
SSDB
Motif
Pfam: MoCF_biosynth
Other DBs
NCBI-ProteinID: ACM57521
UniProt: B9LQA0
LinkDB
Position
1:complement(1943362..1944078)
AA seq 238 aa
MSDAGDGHDHDHHDESDHNGQHDATHDGQHDATHDDHDHHDHDADSVAIAVVTVSSSRSL
DEDPSGDHVVAAFEDADHETVVRELIPDEYDSVQGTVDRLARRKDTDAVVTTGGTGVTPD
DVTPEAVKGLFAKTLPGFGELFRRLSYEEIGTRTIGSRAIAGVVSATPVFCLPGSENAVR
IGVDEVILPEIGHLVGLAGRGVEDAEEAGDDVEGEIGGNGTKEGDDVETDDTETDDAE
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagcgacgccggcgacggtcacgatcacgaccatcacgacgagtccgatcacaacggc
cagcatgacgccactcacgacggccagcatgacgccactcacgacgaccacgaccaccac
gaccacgacgccgattcggtcgcgatcgcggtcgtcacggtatcgtcctcgcggtcactc
gacgaggacccctccggcgaccacgtcgtcgccgcgttcgaggacgccgaccacgagacc
gtcgtccgcgaactgatccccgacgagtacgacagcgtgcaggggaccgtcgaccggctc
gcgcgccggaaggacacggacgcggtcgtgaccaccggcggaacgggggtgacgcccgac
gacgtgactcccgaggccgtgaaagggctgttcgccaagacgctccccggcttcggcgag
ctgttccgccggctctcctacgaggagatcgggactcgtacgatcggctcgcgagcgatc
gcgggggtcgtctccgccacgcccgtcttctgtctgcccggctctgagaacgcggtccgg
atcggcgtcgacgaggtgatcctccccgagatcggccacctcgtcgggctcgcgggacgg
ggcgtggaggacgcggaggaggccggagacgacgtcgagggagagataggaggtaacggg
acgaaggagggagacgacgtggagaccgacgacacagaaaccgacgacgcggagtaa

DBGET integrated database retrieval system