KEGG   Halorubrum lacusprofundi: Hlac_2117
Entry
Hlac_2117         CDS       T00856                                 

Name
(GenBank) PfkB domain protein
  KO
K18478  sulfofructose kinase [EC:2.7.1.184]
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hlac_2117
Enzymes [BR:hla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.184  sulfofructose kinase
     Hlac_2117
SSDB
Motif
Pfam: PfkB Semialdhyde_dh
Other DBs
NCBI-ProteinID: ACM57694
UniProt: B9LR40
LinkDB
Position
1:complement(2107331..2108347)
AA seq 338 aa
MTDSPPVLAVGAAAIDEWYAVSNLPEPDGGAFASEVTTAFGGVGANVCVALDRLGREVGL
VSRVGDDEYGRRAFEYLADTGVDASRVSVGNDPSTRSVILSDPAGERTIVTTGESFRRLR
LNETDREALAAADIVFLTGYTPDAVSRAVLDTIESAADPPALVFDLSGSVEELVGRGTES
ETIHRYLHAADLFVADDVAAAAYFGGPDAAVDRVAAAQQAREANGRSPVTGDGWPRAVLT
HGADGMTVVADGAVTEFDAFDVDVVDATGAGDSFVAGLIDRWIAGSDSGDDPRRERAGVA
DGVRFAAAVAAINCTSRFAQTGLPTRDDVEAFLAERGF
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaccgactctcctccggtcctcgcagtcggcgccgcagcgatcgacgagtggtacgcc
gtcagcaacctccccgagccggacggcggcgcgttcgcgagcgaggtgacgaccgcgttc
ggcggcgtcggcgccaacgtctgcgtcgcgctcgatcgactcggacgcgaagtcggactc
gtgagccgcgtcggcgacgacgagtacggtcggcgggccttcgagtacctcgcggacacc
ggggtcgacgcctcgcgcgtctctgtcgggaacgacccctcgacgcggtcggtgatcctc
agcgatcccgcgggcgagcgcaccatcgtcactacgggcgagagcttccgacgcctccgg
ctgaacgagacggaccgtgaggcgctcgcggcggccgatatcgtcttcctcaccgggtac
acgcccgacgcggtctcgcgggcggtgctcgataccatcgagtcggccgccgatccgccc
gcactcgtcttcgacctctcgggttcggtcgaggaactcgtcggtcgcgggacggagtcg
gagacgatccaccggtacctccacgccgcggacctgttcgtcgccgacgacgtggcggcc
gcggcgtacttcggcggcccggacgcggcggtggaccgcgtcgcggccgcacagcaggcg
cgcgaggcgaacggtcggtccccggtgaccggcgacggctggccccgcgccgtcctgacc
cacggcgccgacgggatgacggtcgtcgctgacggcgcggtcaccgagttcgacgcgttc
gacgtcgacgtggtcgacgcgaccggggccggggactcgttcgtcgcggggctgatcgac
cggtggatcgccgggagcgacagtggtgacgacccacgccgcgagcgcgccggcgtcgcc
gacggcgtccggttcgcggccgcggtcgccgcgataaactgcacgtcccggttcgcccag
acggggcttccgactcgcgacgacgtggaggcgttcctcgcggagcgaggattctga

DBGET integrated database retrieval system