KEGG   Halorubrum lacusprofundi: Hlac_2182
Entry
Hlac_2182         CDS       T00856                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00340  Histidine metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01230  Biosynthesis of amino acids
Module
hla_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Hlac_2182
Enzymes [BR:hla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Hlac_2182
SSDB
Motif
Pfam: PRA-CH
Other DBs
NCBI-ProteinID: ACM57759
UniProt: B9LRA5
LinkDB
Position
1:complement(2168995..2169378)
AA seq 127 aa
MTDADADQGAIEVDFGDDGLVPAVAQDADSGEVLMLAYVSPEALERTRETGEAHYYSRSR
DELWHKGGSSGHTQEVREVRVDCDADTLLYLVDQNVGACHTGHRSCFYRTVDGEHVGERV
FDPDEVY
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaccgacgccgacgcggatcagggggctatcgaggttgacttcggcgacgacggcctc
gtcccggcggtcgcgcaggacgccgattcgggcgaggtgctcatgctcgcgtacgtctcg
ccggaggcactcgaacgcacccgcgagacgggcgaggcgcactactactcgcggtcgcgc
gacgaactgtggcacaagggcggttcctcggggcacacccaggaagtccgcgaggtgcga
gtcgactgcgacgccgacaccctgctgtacctcgtcgaccagaacgtgggggcgtgtcac
acggggcaccgctcgtgtttctaccggacagtcgacggtgaacacgtcggcgagcgcgtc
ttcgacccggacgaggtgtactga

DBGET integrated database retrieval system