KEGG   Halorubrum lacusprofundi: Hlac_2616Help
Entry
Hlac_2616         CDS       T00856                                 

Definition
(GenBank) lysine biosynthesis enzyme LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00300  Lysine biosynthesis
hla01100  Metabolic pathways
hla01210  2-Oxocarboxylic acid metabolism
hla01230  Biosynthesis of amino acids
Module
hla_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:hla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Hlac_2616
Enzymes [BR:hla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     Hlac_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 CPSase_L_D2 ATP-grasp_5 ATP-grasp ATPgrasp_ST Rimk_N
Motif
Other DBs
NCBI-ProteinID: ACM58187
UniProt: B9LTZ3
LinkDB All DBs
Position
1:complement(2597407..2598291)
Genome map
AA seq 294 aa AA seqDB search
MQIGILYSRIRKDEKLLLGELRDRGHEVEKIDVRKERFGLESTTANVEDLDIVVDRCLST
SRSLYATKFLDSYGVPVVNSPETGDICADKAKNSLALAEADIPTPATEVTFTKEAAMESI
EEFGYPCVLKPVVGSWGRLMAKIDTRNAAEAILEHKETLGHYEHKVFYIQEFVDKPGRDI
RALAVDGEPIAAMTRSSDHWLTNAAKGGETKSFDLDDRALDLVERASEAVGGGMLGVDLM
EVGGTGSGEYTVHEVNHTVEFKALDAATDVDVPAKVVDWLEAKVAAADGEEVTA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatagggatcctctactcgcggatccggaaagacgagaagctgctgctcggcgag
cttcgcgaccgcggccacgaagtcgaaaagatcgacgtccggaaagagcggttcggactc
gaatcgacgaccgcgaacgtcgaggacctcgatatcgtcgtcgaccgctgtctgtcgacg
agtcggtcgctgtacgcgaccaagttcctcgacagctacggcgtcccggtggtgaactcc
cccgaaacgggcgacatctgcgccgacaaggcgaagaactcgctcgcgctcgccgaggcg
gatattcccaccccggcgacggaggtcacgttcacgaaggaggccgcgatggagtcgatc
gaggagttcggctacccctgcgtgctcaagcccgtcgtcggctcgtggggccggctgatg
gcgaagatcgacacgcggaacgccgcagaggcgatcttagagcacaaggagacgctcggc
cactacgagcacaaggtgttctacatccaggagttcgtcgacaagcccggccgcgacatc
cgcgcgctggcggtcgacggcgagccgatcgctgcgatgactcggtcgtccgatcactgg
ctcacgaacgccgcgaagggcggcgagacgaaatcctttgatctcgacgaccgcgcgctg
gatctggtcgagcgcgcctcggaggcggtcggcggcggcatgctcggcgtcgacctgatg
gaggtcggtggtaccggctccggcgagtacaccgttcacgaggtgaaccacacagttgag
ttcaaggcactcgacgctgccaccgacgtcgacgttcccgcgaaggtcgtcgactggctg
gaggcgaaggtcgcggcggccgacggcgaggaggtcacggcatga

DBGET integrated database retrieval system