KEGG   Halorubrum lacusprofundi: Hlac_2977
Entry
Hlac_2977         CDS       T00856                                 

Name
(GenBank) transposase, IS605 OrfB family
  KO
K07496  putative transposase
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Hlac_2977
SSDB
Motif
Pfam: OrfB_Zn_ribbon OrfB_IS605 Zn_Tnp_IS1595 TF_Zn_Ribbon zf_Rg C1_2 DZR zf-ACC
Other DBs
NCBI-ProteinID: ACM58523
UniProt: B9LWD3
LinkDB
Position
2:237296..238549
AA seq 417 aa
MANLTVTRTYVGSIQNHRQVSDGLDSLGDSASKIWNVARWTVDRIWDVTGEIPDEGVLKS
CMKNRSCWKDLNAQSSQKVIEELSDAFQSWFDLRHKFDEANPPGYRKHGDTRPRSTVTFK
EDGFKHDPENNRVRLSKGSNLKEYWSDFILCEYQTRPDIDLSEVNRVQNVRAVWNGDEWE
LHFVCKVELESADPAGDEVAGIDLGIKNIATIAFPDEYVLYPGNSLKEDKHYFKRAEYDT
EGENGPSEKSMWARRKLADRETHFYHVLSDTIITECVERGVGTLAVSWPEDVRDSDWGKT
GNKKLHSWAFDRIYQYLAYKGEIHGVEVLKENEWNTSKTCSNCGDDTKENRVERGLYVCS
SCGLVGNADCNGAENMRQKITPSPHGEDRSNGCVAQPSTYLFDREIGTFHTREQAVS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcgaatctcaccgtcacgcgcacctacgttggttctatccagaaccatcggcaggtg
tctgatggtctggattcgctcggggattccgcctcgaaaatctggaacgtcgcacgatgg
acagttgaccgaatctgggatgtaaccggagaaatcccagacgagggcgttctgaaatcg
tgtatgaagaaccggtcgtgctggaaagacttgaacgcgcaatccagtcagaaagtcatc
gaagaactttctgacgctttccagtcgtggttcgacctgcgacacaagtttgacgaggcg
aatccacccggctaccgcaaacacggcgacacccgaccgcgttccacggtgacattcaaa
gaagacggattcaaacacgaccccgagaacaaccgcgtccggctctcgaaaggctcgaac
ctgaaagaatactggtcggacttcattctctgcgagtaccagacgcgccctgacattgac
ctctctgaagtcaaccgagtgcagaacgttcgcgccgtctggaacggcgacgagtgggaa
ctgcacttcgtctgcaaagtcgaactcgaatctgccgacccagcaggcgacgaagtggcg
gggattgaccttggcatcaagaacatcgccacgatcgccttcccggacgaatacgttctc
taccccggtaactcgctcaaagaagacaagcactacttcaaacgagccgagtacgacacc
gaaggtgagaacggcccctcggagaagtcgatgtgggcgcgtcggaaactcgctgaccgc
gaaacacacttctaccacgtcctctcagacaccatcatcacagagtgtgtcgaacgcggt
gttggtacactcgcggtgagttggcccgaagacgtgcgagattcagactggggcaaaact
gggaacaagaagttacactcgtgggcgttcgaccgcatctaccagtacctcgcgtacaaa
ggcgagattcacggtgtcgaggtgttgaaggagaacgagtggaacacctcaaagacctgc
tcgaactgtggtgacgacacgaaggagaaccgtgtcgagcgtgggttgtacgtctgctcg
tcgtgcggtttggttgggaacgcggattgcaacggggcggagaacatgcgtcagaagata
actccgagtcctcacggagaggataggagtaacggctgtgtggcacagccatcgacatac
ttgttcgaccgcgagatcgggacgtttcacacgagagaacaagccgtgtcgtag

DBGET integrated database retrieval system