KEGG   Halobacillus litoralis: HLI_02570Help
Entry
HLI_02570         CDS       T05828                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hli  Halobacillus litoralis
Pathway
hli00010  Glycolysis / Gluconeogenesis
hli00020  Citrate cycle (TCA cycle)
hli00620  Pyruvate metabolism
hli01100  Metabolic pathways
hli01110  Biosynthesis of secondary metabolites
hli01120  Microbial metabolism in diverse environments
hli01130  Biosynthesis of antibiotics
hli01200  Carbon metabolism
Module
hli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HLI_02570
   00020 Citrate cycle (TCA cycle)
    HLI_02570
   00620 Pyruvate metabolism
    HLI_02570
Enzymes [BR:hli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HLI_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 ATP-synt_ab_Xtn TFIIF_alpha GCV_H HlyD_3 Atrophin-1 DUF896
Motif
Other DBs
NCBI-ProteinID: QAS51168
UniProt: A0A410M913
LinkDB All DBs
Position
complement(493475..494788)
Genome map
AA seq 437 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIAKWFVKPGDEIKEDDVLCEVQNDKAVVEIPSQVDGTVKEIH
VDEGETTTVGTVIITIDDGSEDTGSSEEEEEPKEEEKEAPKEESKEEKEDSGSDQPAASS
DDSDVDEDKRVVAMPSVRKFARDNEVDIRKVQGSGKNGRVLKEDVESFMDGGQAEAASEG
SADQQQEESAETSTQQAAPAAGEAYPETREKMSGIRKAISKAMVNSKHTAPHVTLMDEVD
VSELVAHRKKFKSVAAEQEIKLTYLPYVVKSLVSTLKKYPVLNTSIDDNTDEIIQKHYYN
IGIAADTEKGLMVPVVKDADRKSVFSISSEINELAVKARDGKLSSEEMKGASTTITNIGS
AGGQWFTPVINHPEVAILGIGRIADKPIVRDGEVVVAPVLAISLSFDHRIIDGATAQHAM
NNIKRLLNDPQLIMMEA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagctgcctgatatcggtgaaggtatccacgaaggtgaaatcgca
aaatggttcgtaaaacctggcgatgaaatcaaagaagatgatgtcctttgtgaagtgcaa
aatgataaagctgtcgttgagatcccttctcaagtagatggaactgtcaaagaaatccat
gtagacgaaggcgaaacaactactgtaggaacagtcatcattacaattgatgatggttct
gaagatactggttcttctgaagaagaagaggagccgaaagaagaagaaaaagaggcacca
aaagaagaaagcaaagaagaaaaagaagatagtggatctgatcaaccagctgcatcttcc
gacgatagcgatgttgatgaagacaagcgtgtcgtagcgatgccttctgtacgcaaattt
gctcgtgataatgaagtagacatccgcaaagttcaaggatccggcaaaaacggccgtgtt
cttaaagaagacgtggaaagcttcatggacggcggacaagcagaagcagcatcagaagga
tctgctgatcaacagcaagaagaaagtgcagaaacttcaactcaacaagcagcacctgct
gctggagaagcctatccagaaacacgcgagaagatgagcggaatccgtaaagcgatttcc
aaagctatggttaactccaagcatacagctcctcacgtaactcttatggatgaggtggat
gtctctgagcttgtagctcaccgtaagaagttcaagtcagtcgcagctgagcaggagatc
aagctgacgtatcttccatatgtcgtgaagtctcttgtttctacactgaagaaatatcca
gtcctaaatacgtcaattgacgacaatacggatgaaattattcagaaacactattataat
attggtatcgcagcagatacggagaaaggactcatggttccagtcgtaaaagatgcagac
cgcaagtccgtattctctatctcaagcgaaatcaacgaactagctgtgaaagctcgtgac
ggtaaactttcatctgaagaaatgaaaggtgcttccactacaattacaaatatcggatct
gccggtggacaatggtttacaccagtcatcaaccacccagaagttgcaatccttggaatc
ggccgtatcgctgataaaccgatcgtccgtgatggcgaagtagttgttgctccagttctt
gcgatttccttgagcttcgaccaccgtatcatcgatggtgcgacagctcagcacgcaatg
aataacatcaagcgtttactgaacgatccacaactaatcatgatggaggcgtaa

DBGET integrated database retrieval system