KEGG   Halobacillus litoralis: HLI_04405Help
Entry
HLI_04405         CDS       T05828                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hli  Halobacillus litoralis
Pathway
hli00040  Pentose and glucuronate interconversions
hli00051  Fructose and mannose metabolism
hli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HLI_04405
   00051 Fructose and mannose metabolism
    HLI_04405
Enzymes [BR:hli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     HLI_04405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 HI0933_like AlaDh_PNT_C UDPG_MGDP_dh_N FAD_binding_3 2-Hacid_dh_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QAS51515
UniProt: A0A410M9W8
LinkDB All DBs
Position
complement(859918..860949)
Genome map
AA seq 343 aa AA seqDB search
MKALVKTELGFGNLEIQEKQEPIVGEHQVKIEVKYAGVCGSDIHTYEGHYKVNVPVTLGH
EFSGVVVDVGKGVTEFNIGDRVTSETTFYVCGECKYCQNGDYNLCNHRKGLGTQQDGGFA
KYLIARKESVHLLPPHVDDRSAAMTEPLACTHHAVAKTEINEGDVVVVIGPGPIGLFTAQ
VAKSRGARVIIAGLSNDQIRLNKAEELGIDYAINIQEQNLKDLVHKLTDGYGADVVFECS
GAVPAANQALDLLKKKGQYGQVGIFPSPEVSFDLEKIIQKEIRVVGSRSQKSADWEPSLE
LMNFGRVNAQSLVTHEYPITHWEDAYKAIKSGEAIKVLLTPVE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcactcgttaaaacagagcttgggttcggaaatctggaaatccaggaaaagcag
gagccgattgtgggcgagcatcaagtgaaaatagaggtgaaatacgctggggtttgcggg
tcggacattcatacttacgaaggacattacaaagtgaatgtacctgtcaccttaggccat
gaattctccggtgttgtcgttgatgtggggaagggagtaacggaattcaacattggtgac
cgtgtaacatctgaaacgacattttatgtatgtggcgaatgtaagtactgccaaaatggt
gactataacctttgtaatcacaggaaggggcttggaacccagcaggatggtgggtttgcc
aaatatctgattgccaggaaagaaagcgtccaccttcttccgccacacgttgatgatcga
tctgctgctatgaccgagccgcttgcctgcacccatcatgcagtggcaaagacagaaatc
aatgagggagacgtcgtcgttgtaattggtcccggaccgatcgggttatttacagctcaa
gtagcaaaaagcagaggagcaagagtgatcatcgccggattgtccaacgatcaaatccga
ctgaacaaagcggaagaattaggaatagattatgcaattaatattcaagaacaaaacctt
aaagatttggttcataagctgacggatggatacggagccgatgtggtgtttgaatgttca
ggcgccgtcccagcagctaatcaagccttggatttgttaaagaaaaaaggacaatatggc
caagtcggaatctttcctagcccggaagtatcttttgaccttgaaaagattattcaaaaa
gaaatcagagtggtcggaagccgaagtcaaaaatcagccgattgggaaccttctctcgaa
ttgatgaactttggtcgagtgaacgctcaatcgcttgtcactcatgagtatccgattaca
cactgggaagatgcttacaaggcaatcaaaagcggggaagccattaaagttttattgact
cctgtcgagtaa

DBGET integrated database retrieval system