KEGG   Halobacillus litoralis: HLI_06690Help
Entry
HLI_06690         CDS       T05828                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hli  Halobacillus litoralis
Pathway
hli00010  Glycolysis / Gluconeogenesis
hli00053  Ascorbate and aldarate metabolism
hli00071  Fatty acid degradation
hli00280  Valine, leucine and isoleucine degradation
hli00310  Lysine degradation
hli00330  Arginine and proline metabolism
hli00340  Histidine metabolism
hli00380  Tryptophan metabolism
hli00410  beta-Alanine metabolism
hli00561  Glycerolipid metabolism
hli00620  Pyruvate metabolism
hli00625  Chloroalkane and chloroalkene degradation
hli01100  Metabolic pathways
hli01110  Biosynthesis of secondary metabolites
hli01120  Microbial metabolism in diverse environments
hli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HLI_06690
   00053 Ascorbate and aldarate metabolism
    HLI_06690
   00620 Pyruvate metabolism
    HLI_06690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HLI_06690
   00561 Glycerolipid metabolism
    HLI_06690
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HLI_06690
   00310 Lysine degradation
    HLI_06690
   00330 Arginine and proline metabolism
    HLI_06690
   00340 Histidine metabolism
    HLI_06690
   00380 Tryptophan metabolism
    HLI_06690
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HLI_06690
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HLI_06690
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HLI_06690
Enzymes [BR:hli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HLI_06690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra Cas_Csd1 HSCB_C
Motif
Other DBs
NCBI-ProteinID: QAS51925
LinkDB All DBs
Position
complement(1284264..1285688)
Genome map
AA seq 474 aa AA seqDB search
MRNYLKHYINGEWIDSTGDETEDVINPATEEVIGTISLGTKEDLDKAVKAARAAFPSFSQ
TSKQERIELLERIAQEYEKRKDDIIETITDELGSPLSVSENVHYMMGYNHFAQAAESLKE
FSFIENRGGHTVMKDTIGISGLITPWNFPTNQTSTKIASAFAAGSPVILKPAELTPFAAV
ILTEIFEAAGVPKGVFNLVNGSGSVIGNGISSHPDIDFVSFTGSGAVGQKIMENASETIK
NFALELGGKSPLVVLDDADVEQAARTAVGHIATNTGQVCSAATRVLVPSSMKESFEKAVK
NVLPEFPVGDPREDNRTGPLVAKKQWDTVQSYIEKGQEEGATLLVGGTGKPEGLDKGYYA
KPTVFTDVKNDMVIAQEEIFGPVMSIITYDSIDEAIEIANDTYYGLAGYVVGENPENLRK
VASGIRAGRVKVNDAEADFAAPFGGYKRSGIGREWGDYGIEEYLETKTILGFPE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaactacttgaagcactatataaatggagaatggatagactcaacaggggatgag
acagaagatgtcatcaatcccgctactgaagaagtcatcggtaccatcagtctaggtacg
aaagaagatcttgataaagctgtaaaagcagcccgtgctgcctttccttctttttctcaa
acttcaaaacaggaaagaattgaattactggaaagaattgcccaggaatatgaaaaaaga
aaagacgatataatcgaaacgattacagatgaattgggttctcccttgtcggtatcagaa
aatgtacattatatgatgggttataatcattttgcccaagcggcagaatcactgaaggaa
ttttctttcattgaaaaccgaggcgggcataccgtcatgaaagatacgatcggtatcagt
ggtcttattacaccttggaacttcccgacaaatcagacgtccactaagattgcaagtgct
tttgctgccggtagtcctgtcatattgaagcctgcagagcttacgccgttcgctgctgtc
attttaacagaaatatttgaagcggctggcgtaccgaagggtgtatttaatttagtgaat
ggttctggctcagtgatcggtaatggaatcagctctcatccggatatcgattttgtatcg
tttacaggttcaggagctgtcggtcaaaaaattatggaaaatgcatctgaaacaatcaaa
aactttgcccttgagttaggtgggaaatccccacttgtcgtccttgatgatgcagatgtt
gagcaagctgccagaacagcggttggccatattgctacaaacaccggtcaagtttgttcc
gcagcaactcgtgttcttgttccatcttccatgaaggaatcatttgaaaaggctgttaaa
aatgttcttcctgaatttccggttggagatccacgagaagacaatcgtactggtcccttg
gttgcgaagaaacagtgggatactgtccaatcatatattgaaaaagggcaggaagaagga
gctactcttcttgtcggtggaacaggtaaacctgaaggattggataaaggttattatgca
aaaccgactgtcttcacagatgtgaaaaatgacatggtaattgctcaggaagaaattttc
ggaccggtcatgtccatcattacctatgattccattgatgaagcgatagagatagctaat
gatacgtattatggtttagcgggctacgtggtaggtgaaaatccagagaacctaagaaag
gtagcttcaggaatcagggctgggcgtgtaaaagtgaatgacgctgaagctgattttgct
gctccattcggtggctataaacggtcaggcatcggaagagagtggggagattacggaatt
gaagagtatttggaaacgaaaacaattttaggcttccctgaataa

DBGET integrated database retrieval system