KEGG   Halobacillus litoralis: HLI_12740Help
Entry
HLI_12740         CDS       T05828                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hli  Halobacillus litoralis
Brite
KEGG Orthology (KO) [BR:hli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HLI_12740
Enzymes [BR:hli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HLI_12740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 FAD_oxidored Thi4 DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thioredoxin_4 K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: QAS52996
UniProt: A0A410MEE8
LinkDB All DBs
Position
complement(2455375..2456907)
Genome map
AA seq 510 aa AA seqDB search
MVLDAQIKAQLEEYLKLLEGDIELKVSAGDDDVSRDMLALTDELASMSPKITVQNKELNR
TPSFSVNRPQETTGITFAGVPLGHEFTSLVLALLQVSGRAPKVDQTMIEQIQNISGEYHF
ETYVSLSCHNCPDVVQALNIMSVLNPGISHTMIDGAAFKEEAENNNVMAVPSVYLNGEFF
NGGRTTLEEIVAKISDGPDPEEFTNRDPYDILVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVLDTMTIENFISVKNTEGPKFATSLEEHVKDYEIDIMNLQRVKGLEKNDGMFEVEL
DNGGVLKSKSAIISTGARWRQIGVPGEEEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSG
VEAAIDLAGIVQNVTVLEFADTLKADDVLQERLNSLPNVTVKTNAQTTEITGEDNVNGIT
YIDRASGQEQHIGLEGVFVQIGLVPNTEWLDEDVETNKIGEIITDKKGSTNVPGLFAAGD
VTDSPHNQIIISMGDGANASLGAFDYLIRN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgatgcacaaataaaagcgcaactagaagaatatcttaagcttttagaaggt
gacatcgagttgaaagtcagcgcgggagacgatgacgtctcccgcgacatgctggctctc
accgatgagcttgcctccatgtcaccgaaaatcactgtacaaaataaagaactgaaccgc
acaccaagcttcagcgtgaaccgtcctcaagagactacaggcattacttttgctggtgtt
ccgcttggtcatgaattcacttccctagtccttgctttattgcaggtaagcggacgcgct
ccgaaagtcgatcaaacgatgatcgagcagatccaaaacatcagtggggagtatcatttc
gagacctatgtcagtctaagctgccataactgcccggatgtcgtccaggctctgaatatc
atgagtgtgttgaaccctggcatcagccacacgatgattgacggtgctgcttttaaagag
gaagcggaaaacaacaatgtcatggcggttccatctgtctaccttaatggagaattcttc
aatggcggtcgcacaacccttgaagaaatcgtcgcgaaaatcagtgacggaccggatcca
gaggaattcacaaaccgtgatccttatgacatcctcgttgtcggcggcggacctgctggt
gcgagtgccgcgatttatgccgcacgtaaaggcatccgtaccggaatcgtagcggaacgt
ttcggcggtcaggtccttgatacgatgacgattgagaacttcatcagtgtcaaaaacacc
gaaggcccgaaattcgcaacaagccttgaagagcacgtgaaggactatgagatcgatatc
atgaacctccagcgtgtcaaaggattagaaaagaatgatggcatgttcgaagtagaactc
gacaatggcggcgtcctgaaaagtaagagtgcaatcatctcgacaggcgcacgctggcgt
caaatcggcgtcccaggcgaggaagagttcaagaacaaaggtgtcgcctactgcccacac
tgtgacggtccattgttcgaaggtaaagatgtcgctgtcatcggtggcgggaactccggc
gtcgaagcagccatcgatcttgctggaatcgtgcaaaatgtcactgtgctcgaatttgct
gacacattgaaagcagacgatgtgctgcaagaacgtctgaacagtcttccgaacgtgaca
gtcaaaacaaatgcccagacgactgagatcaccggtgaagacaacgtcaatggcatcacg
tacatcgatcgtgcatcagggcaggagcagcatatcgggcttgaaggtgtcttcgtccaa
atcgggcttgtaccgaataccgaatggttagacgaagacgttgagaccaacaaaatcggt
gaaattataaccgataaaaaaggctccacgaatgtccctggcttgtttgcagccggagat
gtgacagacagcccgcacaatcagatcattatttctatgggtgatggtgcgaatgcttca
cttggtgcgtttgattacttgattcgcaactga

DBGET integrated database retrieval system