KEGG   Halobacillus litoralis: HLI_13595Help
Entry
HLI_13595         CDS       T05828                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
hli  Halobacillus litoralis
Pathway
hli00010  Glycolysis / Gluconeogenesis
hli00620  Pyruvate metabolism
hli01100  Metabolic pathways
hli01110  Biosynthesis of secondary metabolites
hli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HLI_13595
   00620 Pyruvate metabolism
    HLI_13595
Enzymes [BR:hli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     HLI_13595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: QAS53147
LinkDB All DBs
Position
complement(2643914..2645434)
Genome map
AA seq 506 aa AA seqDB search
MVYANPNTAGSEVNFKERYDNFIGGEWTAPVKGQYFDNVTPVTGQNFCKVARSTEEDVEL
ALDAAHQAKDAWGETSVTERSLILNRIADRMEENLEKLAIAETWENGKAVRETLNADIPL
AIDHFRYFASVIRSQEGSIGEIDNDTVAYHFHEPLGVVGQIIPWNFPILMATWKMAPALA
AGNAIVLKPAEQTPASILYLIEMIEDLLPPGVLNIVNGFGLEAGKPLAQSPRINKVAFTG
ETTTGRMIMQYASQNIIPVTLELGGKSPNIFFEDVMSEDDDFLDKTIEGMVMFALNQGEV
CTCPSRALIHESICDEFMDRAIKRIKEIKTGNPLDPEVMMGAQASSEQLEKILSYLEIGK
DEGAECLVGGERNQMDGDLKDGYYVQPTVFKGNNDMRIFQEEIFGPVLSVTTFKDSEEAM
KIANDTLYGLGAGVWTRDMNTAYRFGRGIEAGRVWTNCYHAYPAHAAFGGYKMSGVGREN
HKMMLSHYQQTKNMLVSYSPQKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgctaacccgaacacagcaggttctgaagtgaatttcaaggaacgatacgac
aactttataggcggagaatggacagcacctgtcaaaggccaatactttgacaatgtgaca
cctgtcactggacaaaatttttgcaaggtggcacgttcaactgaagaggatgtagaactt
gctcttgacgctgcccaccaggcaaaagatgcatggggggaaacatcagtaactgaacgc
tccctgatcctgaaccgcatcgccgatcgaatggaagaaaacttggaaaaactagcaata
gccgaaacatgggaaaatggcaaagctgtaagggaaacgttgaacgcagacatcccatta
gctatcgatcatttccgctatttcgcttctgtcattcgttctcaggaaggcagcatcggt
gagattgataatgataccgtcgcctaccatttccatgaaccattaggtgtcgttggacaa
atcattccttggaatttcccgatattgatggcgacttggaaaatggcgcctgccctagct
gcgggaaatgctatcgttttgaaacctgcagaacaaactcctgcatccatcctatatctg
attgaaatgattgaagatctgttaccaccaggtgtattgaatatcgttaatggatttggt
ttggaagcaggaaaacctctagctcaaagtcctagaatcaataaagtcgctttcacaggt
gaaaccacgactgggcgtatgatcatgcaatatgcctctcaaaacatcattcctgtgaca
ttagagcttggtggtaaatcaccaaatattttctttgaagatgtcatgagtgaagatgat
gatttccttgataaaacaatagaaggcatggtcatgttcgcattaaaccaaggggaagtt
tgtacttgtccttcccgtgcgcttatccatgaatccatatgcgatgaatttatggaccgt
gctattaagcgtatcaaggaaattaaaacaggcaacccactagaccctgaagtaatgatg
ggagcccaagcttcctcagagcaattggaaaaaatcttatcctatttagaaattggaaaa
gatgaaggagctgagtgcctggtcggaggagagcgcaatcaaatggatggcgacctcaaa
gatggttattatgtacaacccactgttttcaaagggaacaatgacatgagaatcttccag
gaagaaatcttcggacctgttctttctgttacaacattcaaagactctgaagaagctatg
aaaattgctaatgacacgttatatggcttaggcgctggcgtatggacacgtgatatgaac
acagcctatcgctttggaagaggcatcgaggctggtcgtgtatggacaaactgttaccat
gcctacccggctcatgctgcctttggaggatacaaaatgtccggtgtcggtcgagagaac
cacaagatgatgcttagtcattatcagcaaaccaaaaacatgttagtcagctatagccct
cagaaactaggattcttttaa

DBGET integrated database retrieval system