KEGG   Halobacillus litoralis: HLI_16525Help
Entry
HLI_16525         CDS       T05828                                 

Definition
(GenBank) histidine kinase
  KO
K07777  two-component system, NarL family, sensor histidine kinase DegS [EC:2.7.13.3]
Organism
hli  Halobacillus litoralis
Pathway
hli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hli00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HLI_16525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hli01001]
    HLI_16525
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hli02022]
    HLI_16525
Enzymes [BR:hli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HLI_16525
Protein kinases [BR:hli01001]
 Histidine kinases
  NarL family
   HLI_16525
Two-component system [BR:hli02022]
 NarL family
  DegS-DegU (multicellular behavior control)
   HLI_16525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegS HisKA_3 HATPase_c HATPase_c_2 HATPase_c_3 G-gamma V_ATPase_I CALCOCO1 DUF1848
Motif
Other DBs
NCBI-ProteinID: QAS53695
UniProt: A0A410MGA4
LinkDB All DBs
Position
3293586..3294725
Genome map
AA seq 379 aa AA seqDB search
MSVQKTGDIALDHIINEMVDTVTNSKDEIFQIGEESRSEFEKLNKELTETKKQVLALIDE
GDKLEQKVRFSRMRLSEVSKQFQKYSEEEIRKVYEQTHGLQMDLSMKREKEKQLRERRDD
IELRLRNLEETINRAEALGGKISVVLNYLTEDFKHVTDALEDAKEKQQFGLQIIEAQEEE
RRRLSREIHDGPAQMLANVMLRSDLVDRTYRERGIEDAMQEVKSVRSLVRSALYEVRRII
YDLRPMALDDLGLIPTLKKYLATVEDYNEGMVISFTSFGKERRLESKYEVALFRLVQEAV
QNAVKHAEASEIKVKVEMKPQAAIIIVKDDGKGFNPQEKRDKSFGLVGMRERVDMLEGEL
NIDSSQGEGTIVTIHLPIN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtacaaaagactggggatatcgcccttgaccacatcattaatgagatggtggat
acggtcaccaatagcaaagatgaaatttttcaaattggtgaagaatcccgtagtgaattc
gaaaaacttaacaaagaattgacagaaacgaagaagcaggtgcttgctctgattgatgaa
ggggacaagctggaacaaaaggtccgtttttctcgaatgcgcttgtcagaagtaagtaag
cagttccagaaatattcagaagaagaaattcggaaagtgtacgaacaaacccatggatta
caaatggatttatcgatgaaacgggagaaagaaaagcagctgcgagagcggagagacgat
atcgaattacgcttacgcaacttagaagaaaccatcaaccgcgcagaagccttaggcgga
aaaatctcagtggtgctcaattatcttacagaggatttcaaacatgtcactgacgctctg
gaagacgccaaagagaagcagcaattcggcctgcaaatcattgaggcgcaggaagaagaa
cgccgccggctgtcccgtgaaatccatgacggccccgcgcagatgcttgcaaatgtcatg
ctaaggtcagaccttgtggatcgtacttaccgcgagcgcggaattgaagatgcgatgcaa
gaggtgaagagtgtacggtcattagtccgttctgccctttatgaagtgcggcggatcatt
tatgacctgcgtccgatggctttggatgacctcggattgattccgactttgaagaaatat
ttagctaccgtcgaagactacaatgaaggaatggtcatttcattcacttcattcgggaaa
gagcgccgtttggaatcaaaatatgaagtggcgcttttccgcttggtccaggaagcggtt
caaaacgcggtgaagcatgcggaggcttcagaaatcaaggtgaaagtggaaatgaaacca
caagcagccatcatcattgtcaaagacgatggcaaaggtttcaatcctcaagaaaagaga
gataagtccttcggcttagttgggatgagagaacgcgtcgatatgcttgaaggcgaactt
aacattgattccagccaaggagaagggactattgtaacgattcatctgccaataaattga

DBGET integrated database retrieval system