KEGG   Halostagnicola larsenii: HALLA_14155Help
Entry
HALLA_14155       CDS       T03008                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hlr  Halostagnicola larsenii
Pathway
hlr00620  Pyruvate metabolism
hlr00680  Methane metabolism
hlr00720  Carbon fixation pathways in prokaryotes
hlr01100  Metabolic pathways
hlr01120  Microbial metabolism in diverse environments
hlr01200  Carbon metabolism
Module
hlr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HALLA_14155
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HALLA_14155
   00680 Methane metabolism
    HALLA_14155
Enzymes [BR:hlr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HALLA_14155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Activator-TraM
Motif
Other DBs
NCBI-ProteinID: AHF99757
UniProt: W0JRY8
LinkDB All DBs
Position
1737789..1740479
Genome map
AA seq 896 aa AA seqDB search
MDLHNRDVRQDVRELGALLGDVLEEQTSRRAFNTVESCRQTAIDYRSGDLDSRDPLVDEL
EGLSPHQQRIVARAFTTYFELINLAEERERVRSIREGSQEGSLDDSLEMVAEELAEEDKE
TAQQILDDVLIEPTFTAHPTEARRKTVKSKLREVSNHLETLDERLLTDKERGQVWRDVDA
EVTSLWQTPQVRKRQPEPEDEARNVQWYLENTLFDVVGEVYDEFGVALEEELDADVDLPK
LFEFRSWAGSDRDGNPYVTPEVTANTLERQRSVVLERYREQLKRLSGVLSQDGSRLEVDG
PFESSLEEDRERLPGSAQTAQTRYPGEPYRQKLKLMRERLDRVGDVRPGGYADVDELLGD
LELIATSLRENGAETVVEAHVDPIRRQVETFGFSLASLDLREHQAKHTDAIAEALEREGI
DYRGLSEDERVEFLTDAVLQDETVIDLEAVEDLSDASTRVLTLFDELADWQTEYGVEAID
TYAISMTDEPSHVLEVLFLADQSGIISLPEHCGIDIVPLLETEYALSGARRIMGTLFENE
AYAQALEARGRTQEIMLGYSDSNKENGFLAANWSLYKNQRRLGEICEDYDVTMRLFHGRG
GSISRGGGPMNEALLALPNSTVTGQVKFTEQGEAIAEKYGNPRIAERNIEQMLNAQLRAR
RNAIDQPEEEIRDEWIDAMETMATAARQEYRDLLESDGFVQYFEQATPITVIEDLDLGSR
PASRSGERTVEDLRAIPWVFSWTQSRCILPGWYALAAGIGAYLEDGGSMDTLQEMYDEWP
FFRSTLDNAALSLSRTELEIAAEYADLADDDLREEFFPRVSEEYEQAAEYVTTIGRRDQL
HTRDWLGENLERRNPYVDPLNVLQTYLLDRSHRTDVEERTLRLTVKGIAAGMKNTG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcacaacagggacgtacgccaggacgttcgcgaactgggtgcactgctcggt
gacgtcctcgaggaacagacctctcgacgggcgttcaacacggtcgaatcgtgccggcag
accgcgatcgactaccgttccggcgatctggatagtcgggatccgctggtcgacgaactc
gaagggttatcgccccaccaacagcgaatcgtcgcccgcgcgttcacgacctacttcgaa
ctgatcaacctcgccgaagaacgcgagcgggtgcggtcgattcgcgaaggctcccaggag
ggatcgctcgacgatagtctcgagatggtcgccgaggaactagcagaggaggacaaagag
accgcacagcagatcctcgacgacgtgctcatcgagccgacctttaccgcccatccaacc
gaagcgcgccgaaaaacggtcaaatccaagcttcgggaagtctcgaaccacctcgagacg
ctcgacgagcggctgttgaccgacaaggaacgcggccaggtctggcgcgacgtcgacgcg
gaggtgacgagcctctggcagacgccacaggttcgcaaacgccagccggagcccgaagac
gaagcgcgaaacgtccagtggtacctcgagaacacgcttttcgacgtcgtcggcgaagtt
tacgacgagttcggcgtcgccctcgaggaggaactcgacgcggacgtcgacctgccgaag
ctcttcgagttccgttcgtgggccggcagcgaccgcgacggaaacccctacgtcacccct
gaagtcaccgcgaacacgctcgagcgccagcggtcggtcgtcttagagcggtatcgcgaa
cagctcaaacgactctcgggcgtcctgagtcaggacggaagccgcctcgaggtcgacggt
ccgttcgagtcgagtctcgaagaagaccgagagcggttgcccggtagcgcacagaccgca
cagacccgctatccgggcgaaccctaccgacagaagctcaaactcatgcgcgaacggctc
gaccgcgtcggcgacgttcgaccgggcgggtacgcagacgtcgacgaactcctgggcgac
ctcgagttgatcgcgaccagcctgcgggaaaacggcgccgaaaccgtcgtcgaagcccac
gtcgatccgatccgccgacaggtcgagaccttcggcttctcgcttgccagtctcgacctc
cgcgaacaccaggccaaacacaccgatgctattgcggaggcactcgagcgcgaaggaatc
gactaccgcggcctctcggaggacgaacgcgtcgagttcctcaccgacgctgtcttgcaa
gacgagacggtgatcgatctcgaggccgtcgaggatctctcggacgcctcgacgcgcgtg
ctcacgctcttcgacgaactcgccgattggcagaccgagtacggcgtcgaagcgatcgac
acctacgccatctcgatgaccgacgagccgagtcacgtcctcgaggtgctgtttctggcc
gaccagtccggaatcatttccctgcccgaacactgcgggatcgatatcgtcccgctgctc
gagaccgagtacgccctttcgggtgcccgccgtatcatgggcacgctcttcgagaacgag
gcctacgcccaggcgcttgaggcccgcggacgcacccaggaaatcatgctggggtactcg
gactcgaacaaggaaaacggcttcctggcggccaactggtcgctgtacaagaaccagcgc
cgactcggggagatctgcgaggactacgacgtgacgatgcggctgttccacggtcgcggc
ggttcgatctctcggggcggcggcccgatgaacgaggcgctgctggcgttgcccaacagc
accgtgaccggccaggtcaagttcaccgaacagggcgaggcgatcgccgagaagtacggt
aacccgcgcatcgccgagcgaaacatcgagcagatgctcaatgcccaacttcgcgcccgt
cggaacgcgatcgaccagcccgaagaggagattcgcgacgagtggatcgacgccatggaa
accatggcaaccgccgcccgacaggagtaccgagacctcctcgagagcgacggcttcgtc
cagtacttcgaacaggcgacgccgatcaccgtcatcgaagacctcgatctgggctcgcga
cccgcctcccgcagcggcgagcgaacggtcgaggacctgcgggcgattccgtgggttttc
tcgtggacccaatcgcggtgtatcctccccggctggtacgcgctcgccgccggaatcggc
gcgtacctcgaggacggcggctcgatggataccctccaggagatgtacgacgagtggccg
ttcttccgctcgaccctcgacaacgccgccctctcgctctcgagaaccgaactcgagatc
gccgccgagtacgccgaccttgctgacgacgacctccgcgaggagttcttcccgcgcgtc
tccgaggagtacgagcaggctgccgagtacgtcacgacgatcggtcggcgcgaccagttg
cacacccgtgactggctcggcgagaacctagagcgtcgaaacccctacgttgacccgctg
aacgtcctgcagacgtatctgctggatcgatcgcacagaaccgatgtcgaggaacgaacg
cttcggttgacagtcaaggggatcgccgccggcatgaaaaacaccggctaa

DBGET integrated database retrieval system