KEGG   Haloarcula marismortui: rrnAC1840Help
Entry
rrnAC1840         CDS       T00211                                 

Gene name
smc1
Definition
(GenBank) structural maintenance of chromosomes
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
hma  Haloarcula marismortui
Brite
KEGG Orthology (KO) [BR:hma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hma03400]
    rrnAC1840 (smc1)
DNA repair and recombination proteins [BR:hma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     rrnAC1840 (smc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 AAA_29 AAA_13 AAA_21 Spc7 AAA_27 SMC_N zf-C4H2 CENP-F_leu_zip Atg14 TMF_TATA_bd MukB ABC_tran
Motif
Other DBs
NCBI-ProteinID: AAV46726
UniProt: Q5V177
LinkDB All DBs
Position
I:complement(1642111..1644837)
Genome map
AA seq 908 aa AA seqDB search
MTTARRASRSSCNGGSTMKFQRVKLSNFKCYDDADLRLDNGVTVIHGLNGSGKSSLLEAC
FFALYGSKALDENLGDVVTIGADDCTVELWFSHAGGDYHLTRRVRATGAQPTTAKCVLET
PEGNYEGARDVRRRITELLRMDSEAFVNCAYVRQGEVNKLINASPGDRQDMLDDLLQLGK
LEAYRERASDARVGVGRVRDDKQGALSQLDEQIQEKEEKDLHERLNGLETKESELQDEIE
HIEDQKATAEETLTQAESVLEEYEEKRDELSTLEADIEDLEATITETETERTELKEQVSD
LQDQRESLREDLSETVAKTDLDSSEPDPETVDARLDELQSRDDELQSRIEDQRVDAKDHS
STADALAESAADLESRAEDKREEAAELETDIEAARETIAERREQISDIDDQIADLEARFE
NAPTDRDGSQSYKESVASDLDNTRQQVTELETKLESERESLAEAEALLEAGKCPECGQDV
AESPHVDSIEDDRGRIAELEELLADAREDVSDLKSEHETATELVETADELSTLENNRSNI
VQLVEEKEAGLDADQERIQTLREEATAHESEAETKREKAAEAREQAEDCRSVVAECNQER
QQVKQSIENLERVEDLLAKIDDCDDDIERLREKRSQQAELNDQRRDQLAEKRERKQDLAE
SFDEDRIEAARSEKQRAKKYIEQAAEALTEKREKRDELQNAIGGVTNEIEELESLRDRRE
DLEATLERLETLYEETEELQEMYGTLRAELRQRNVETLERMLNQTFDLVYQNDSYSHIEL
DGQYQLTVYQKDGEPLEPEQLSGGERALFNLSLRCAIYRLLAEGIEGAAPMPPLILDEPT
VFLDSGHVTQLLDLVEYMRDEVGVEQILVVSHDEELVGAADDLVRVEKDATTNRSRVERV
EATVAELA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccaggcgagcgtcgaggagttcctgtaatggagggtcaacaatgaaattc
cagcgcgtcaagctatccaatttcaagtgttacgacgatgccgacctgcgacttgacaac
ggcgtgaccgtcatccacggactcaacgggagcgggaaatcatctttgcttgaagcctgc
ttcttcgcgctgtacggctcgaaggcactggatgagaatctcggcgacgtggttaccatc
ggagccgacgactgtaccgtcgaactgtggttctcccacgccggtggcgactatcatctc
acgcgccgggtccgcgcgaccggagcacaaccgacgacggcgaagtgtgtgctggagaca
cctgaaggaaactatgagggggcgcgcgacgtgcgccgacgcattaccgaactcttgcgg
atggacagcgaggcgttcgtcaactgcgcctacgtccgtcagggcgaggtgaacaagctc
atcaacgcctcccccggcgaccgccaggatatgctcgacgacctcctgcaactggggaaa
ctggaggcgtaccgcgagcgggccagcgacgcccgcgtcggcgtcggtcgggtacgcgat
gacaaacagggggccctctcacaactcgacgagcagattcaggagaaagaagaaaaggac
ctccacgagcgcctgaacggcctcgaaacgaaggaatcagagctgcaagacgagatcgaa
cacattgaggaccagaaggccaccgccgaggagacgctcacgcaggccgagtccgtcctc
gaagagtacgaagagaaacgcgacgaactgtcgaccctcgaagccgacatcgaggatctg
gaagcgactatcaccgagacggagacggaacgaaccgagctcaaagagcaggtcagcgac
ctacaggaccagcgagagtcgttgcgagaggacctctcggaaacagtggccaaaaccgac
ctcgacagttcggagccggaccccgaaaccgtcgatgcgcggcttgacgaactgcagtcc
cgcgatgacgaactgcagagccgcatcgaggaccagcgggtcgatgcgaaggatcacagc
agcaccgccgacgcgctggccgagagcgctgccgacctcgaatcccgggccgaggacaag
cgtgaagaagccgccgaactggaaacagacatcgaagctgcgcgggagactatcgccgag
cgccgggagcagatcagcgacatcgacgaccagatcgccgatctcgaagccaggttcgag
aacgcgccgaccgaccgtgacgggtcgcagtcgtacaaagaatccgtcgccagtgacctc
gataacacccgacagcaggtgaccgaactggagacgaaactggagagcgagcgcgagtcg
ctcgcggaggccgaggcgctgctggaggccggcaagtgccccgagtgcgggcaggacgtg
gccgagtcaccgcacgtcgactctattgaggacgaccgtggtcggattgccgagctagag
gagttgctcgcggacgctcgtgaggatgtctcggacctgaagtctgagcacgagaccgcg
acggaactggtcgagacagcggacgagctatcgacgcttgagaacaaccgttcgaacatc
gtccagctcgtcgaagagaaagaagcggggctggatgcggaccaggagcgcatccagacg
ctccgcgaagaagcaacagcacatgagtccgaggctgagacgaaacgcgagaaagccgcc
gaagcccgcgagcaggccgaggactgtcgctcggtcgtcgccgagtgtaatcaggagcgc
cagcaggtcaaacaatcgatagagaacctagagcgggtcgaagacctgcttgcgaagatc
gatgactgcgacgacgacatcgaacgcctgcgagagaagcgcagtcagcaggccgaactg
aacgaccagcgccgcgaccagctcgcggagaagcgcgagcgcaagcaggacctcgcggag
tccttcgacgaggaccgcatcgaagcggctcgaagcgagaagcagcgggcgaaaaagtac
atcgaacaggcagcggaggcactgacggagaaacgcgagaaacgcgacgaactccagaac
gctatcggtggcgtcacgaacgaaatcgaggaactggagtcgctgcgagaccggcgcgaa
gacctcgaagcgacactggagagactcgaaacgctatacgaggaaaccgaggagctacag
gagatgtacgggacgctccgggcagagctgcgccagcgcaacgtcgagacactcgaacgg
atgctcaaccagacgttcgacctggtgtaccagaacgactcgtactcccacatcgaactc
gacgggcagtatcagctgacggtgtaccagaaggacggcgagccgctggagcccgaacag
ctctccggcggcgaacgggcgctattcaacctcagcctgcggtgtgccatctaccgacta
ctcgccgaaggcatcgaaggggccgcgccgatgccgccgctcatcctcgacgaaccgaca
gtgttcctcgattcaggccacgtcacgcaactgcttgacctcgtggagtacatgcgcgat
gaggtcggcgttgagcagattctcgtggtcagtcacgacgaggaactggtcggtgcggcg
gacgacctcgtccgcgtcgagaaagacgccacgaccaatcgctcgcgggtcgaacgggtc
gaagcgacggtcgcggaactggcctga

DBGET integrated database retrieval system