KEGG   Haloarcula marismortui: rrnAC1955Help
Entry
rrnAC1955         CDS       T00211                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hma  Haloarcula marismortui
Pathway
hma00564  Glycerophospholipid metabolism
hma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    rrnAC1955 (glpA)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     rrnAC1955 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 Thi4 FAD_oxidored Pyr_redox HI0933_like NAD_binding_8 NAD_binding_7 Pyr_redox_3 Lycopene_cycl 3HCDH_N GIDA ApbA TrkA_N PALP
Motif
Other DBs
NCBI-ProteinID: AAV46823
UniProt: Q5V0Y0
LinkDB All DBs
Position
I:1743702..1744922
Genome map
AA seq 406 aa AA seqDB search
MAIETDVLVVGGGATGAGVARDLALRGIDVTLVERDGLTSGTSGRSHGLLHSGARYAEAD
RVGAEECITENRILKEIAGACIRDTGGLFVQLAGDDPDYFETKRAACEEIGIPVETLDAD
AARERVPDLASDVERAFEVPDAVIYPSRLVAANAADARDHGATIHPHAPVEDVLVEDGHV
AGVQVGGTVEDTIEADYVVNATGAWAGEFAAMADLDVEMQPTRGVMVSVEYDDLGPVLNR
CRDPDDGDIVVPHESEAVLGTTSVPVRDPDEYETEQWEVEESIEECAAMLPSVADAPEVR
TWWGVRPLYAPDEAERGRGISRGFFLLDHADDGVDNMASIVGGKLTTYRQMAEATADLVC
DDLGVDAACRTADQTLPSVDDPAQLDALVAEFDGQGPTDEDVVGSA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgagacggatgtcctcgtcgtcggtggtggcgcgaccggcgctggcgtcgct
cgtgacctggcactccgtggtatcgacgtgacactcgtcgagcgtgacggcctgacaagt
ggcacctccgggcgctcgcacggactgctgcacagcggtgcccgctacgccgaggcagac
cgggtgggtgccgaggagtgcatcaccgaaaaccggatactcaaggaaatcgccggggcc
tgcatccgcgacaccggggggttgttcgtccagctcgccggggacgaccccgattatttc
gagaccaagcgggcggcctgtgaggagatcggcatcccggtagagacacttgacgccgac
gcggcccgcgagcgagtccctgacctcgcatcggatgtcgagcgcgcgttcgaggttccc
gacgccgtcatctatccgtcgcggctcgtcgccgcgaacgccgcagacgcccgcgaccac
ggcgcaacgatacacccacacgcgcccgtcgaagacgtactcgttgaggacgggcacgtg
gccggcgtgcaggtcggcgggacggtcgaggacaccatcgaagccgactacgtcgtcaac
gcgaccggtgcctgggcgggcgagttcgccgcgatggccgacctcgacgtcgagatgcaa
cccacgcggggtgtgatggtctcggtcgagtacgacgacctcgggccggtgctcaaccgc
tgtcgggaccccgacgacggcgatatcgtcgtgccacacgaaagcgaggccgtcctcgga
acgacaagcgtgcccgtccgtgacccggacgagtacgagaccgaacagtgggaagtcgaa
gagagcatcgaggaatgtgcggcgatgctaccctcagtcgcggacgcccccgaggtccgg
acctggtggggcgtccggccgctgtacgcgcccgacgaggccgagcgcggccgcggcatc
tcgcggggcttcttcttgctcgaccacgccgatgacggcgtcgacaacatggcgagcatc
gtcggcggcaaactgaccacttaccggcagatggccgaggcgacggccgacctcgtctgt
gacgacctcggcgtcgacgccgcttgccggactgcagaccagacgctcccaagcgtcgac
gacccggcgcagttggacgcgctcgtggccgagttcgacgggcagggcccgactgacgaa
gacgtggtcgggtcagcgtaa

DBGET integrated database retrieval system