KEGG   Hyphomicrobium sp. MC1: HYPMC_4756Help
Entry
HYPMC_4756        CDS       T01557                                 

Gene name
fabI
Definition
(GenBank) NADH-dependent enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hmc  Hyphomicrobium sp. MC1
Pathway
hmc00061  Fatty acid biosynthesis
hmc00780  Biotin metabolism
hmc01100  Metabolic pathways
hmc01130  Biosynthesis of antibiotics
hmc01212  Fatty acid metabolism
Module
hmc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HYPMC_4756 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HYPMC_4756 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    HYPMC_4756 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hmc01004]
    HYPMC_4756 (fabI)
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     HYPMC_4756 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     HYPMC_4756 (fabI)
Lipid biosynthesis proteins [BR:hmc01004]
 Fatty acid synthase
  Component type
   HYPMC_4756 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: CCB67964
UniProt: F8JFK4
LinkDB All DBs
Position
4559279..4560148
Genome map
AA seq 289 aa AA seqDB search
MTDIDIAKPGPIMAGKRGLIMGVANDRSIAWGIARVLHGQGAELAFTYQGGAFGRRAVPL
AQSIGSKIIEECNVLDLESVDRVFNRIKDEWGSIDFVVHALAYSDPKELAGRYADTTREN
FINSMVISCFSFTEIAKRASALMPNGGSLITLSYGGATRWVPSYNVMGVAKAALEASVRY
LAADFGPQGVRVNALSAGPMRTLSGAGVSDARVIFNFQRDNSPLQRTPTLDEVAGSALYL
LSPLSGAVTGEVHFVDCGYNTVSMPSLQSLKEQDAEAKPASASPSAAAE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgatatcgctaagcccggcccgatcatggccggcaagcgtggcctcatc
atgggtgttgccaacgaccgttcgatcgcgtggggcattgcccgcgtccttcacggtcaa
ggcgccgagctggcattcacctatcaaggtggcgcattcgggcgccgcgctgtgccgctg
gcgcagtcgatcggctcgaagatcatcgaggaatgcaacgttctcgatctcgaaagcgtc
gatcgcgttttcaatcgcatcaaggacgagtggggcagcatcgactttgtcgtgcacgcg
ctggcctattccgatcccaaagagcttgctggccgctacgccgacacgacgcgcgaaaac
ttcatcaactcgatggtgatctcgtgcttctcgttcactgagatcgcgaagcgcgcttcg
gcgctgatgccgaacggtggctcgctgatcacgctgtcttatggcggtgcgacgcgctgg
gtgccgtcttacaacgtcatgggcgtcgcgaaagccgcgcttgaggcttcggtgcgctat
ctcgcagcggatttcggaccgcagggcgttcgcgtcaatgcgctctcggccggtccgatg
cgcacgctctcgggcgctggcgtttcggatgcgcgcgtgatcttcaatttccagcgcgat
aactcgcctctgcagcgcacgccgacgctcgatgaagtggcgggttcggcgctttatctg
ctgtcgccgctgtcgggcgccgtgacgggcgaagttcacttcgtcgattgcggctataac
accgtgtcgatgccgtcgctgcagagcctgaaagaacaggacgctgaggccaagcccgcc
agcgcatcgccgtcggctgcggcggagtaa

DBGET integrated database retrieval system