KEGG   Hyphomicrobium sp. MC1: HYPMC_4853Help
Entry
HYPMC_4853        CDS       T01557                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hmc  Hyphomicrobium sp. MC1
Brite
KEGG Orthology (KO) [BR:hmc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HYPMC_4853 (ahpF)
Enzymes [BR:hmc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HYPMC_4853 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 K_oxygenase DAO AlaDh_PNT_C NAD_binding_8 Glutaredoxin Thi4 NAD_binding_9 FMO-like
Motif
Other DBs
NCBI-ProteinID: CCB68061
UniProt: F8JE13
LinkDB All DBs
Position
complement(4656539..4658119)
Genome map
AA seq 526 aa AA seqDB search
MLDDALKSQLKGYLEKVVRPIEIRAAVDASAKSIEMVSLLTDITNLSDKITLVEEQNSPD
RTPSFALTTPGQEISLRFAGIPLGHEFTSLVLALLQVGGHPPRVEQAVIDQIRALDGDFS
FETYFSLSCQNCPDVVQALNLMAVLNPRIKHVAIDGGVFPEEVEARQIMSVPTVYLNGDV
FGQGRMDAEQILAKLDTGAAARSAEKIKAQEPFEVLVVGGGPAGAAAAIYAARKGIRTGI
ATERFGGQVLDTAAIENFISVRHTEGPHLAAALEEHVKEYDVEIMNLQRAEKIVRKGEYL
EVELANGAALKSKSVILATGARWRQLGVPGEMEYRNKGVTYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVDHVTLLELDFKLRADEVLQRKLRSLPNVDIITGAKTAKVEGDGQK
VVGIAYESRSTSDKRVLPVDGIFIQIGLLPNTEWLKGALELTPHGEIVVDSHNRSSMPGV
FAAGDCTTTPYKQIVIALGEGAKASLAAFDHLIRISAPDEKEVKAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacgcactcaaatcccagctcaaaggctatttggaaaaggtcgttcgcccg
atcgagattcgcgccgcagtcgacgccagcgccaaatccatcgagatggtcagcctgttg
accgacatcaccaacctctccgacaagatcacgctggtcgaagagcagaacagtcccgat
agaacgccatcgttcgcgctaacgactcctggccaggagattagccttcgtttcgcaggc
attccgctcggacacgaattcacatcgctcgtattggcgctgctccaggtcggcggccac
ccgccccgcgtcgagcaggccgtcatcgaccaaatccgtgcgctcgacggcgacttcagt
ttcgagacctacttctcgctctcgtgccagaactgtcccgatgtcgttcaggcactgaac
ctgatggccgtcctcaatccgcgcatcaagcacgtcgcgatcgacggcggcgtctttcct
gaagaagtcgaagcccgccagatcatgtcggtcccaaccgtctatctgaacggcgatgta
ttcggccagggccgcatggacgccgaacagatcctcgccaagctcgacactggcgcagcc
gcgcgcagtgccgagaagatcaaggcccaggagccgttcgaggtgctggtcgtcggtggc
ggcccggccggcgcggccgccgctatttacgctgctcgcaaaggcattcgcaccggcatc
gccaccgaacgcttcggcggccaggttctcgacaccgctgccatcgagaactttatttcc
gtccgtcacaccgaaggcccgcacctcgccgccgcgctcgaagagcacgttaaggaatac
gacgtcgagatcatgaaccttcagcgcgctgaaaagattgtccgcaagggcgagtatctt
gaggtcgaactggcgaacggcgcagcgctgaaatcgaaatccgtcatcctcgcgaccggc
gcgcgctggcgacagctcggcgttccgggcgaaatggaataccgcaacaagggcgtcacc
tactgcccgcactgcgacggtccgctgttcaaaggcaagcgtgttgccgtaatcggcggc
ggcaactcgggggtcgaggcggcaatcgacctcgccggcatcgtcgaccacgtcacactg
ctcgaactggactttaagcttcgcgccgacgaggtcctgcagcgcaagctccgcagcctg
ccgaacgttgacatcatcaccggcgccaagacggcaaaagtcgaaggagatggccagaag
gtcgtcggcatcgcctacgaaagccgctcgacgtccgacaagcgcgtgctgccggtcgac
ggcatcttcattcagatcggcctgttgccgaacacggaatggctgaaaggcgcgctcgaa
ctgacgccgcacggcgaaatcgtcgtcgactcgcacaatcgcagctcgatgcccggcgta
tttgccgccggcgactgcaccacgacaccctacaagcagatcgtcatcgccctcggcgaa
ggcgccaaagcctcgcttgcggcctttgaccaccttatccgcatctcggcgccggacgaa
aaagaggtcaaagccgcttaa

DBGET integrated database retrieval system