KEGG   Halomonas meridiana: CTT34_06235Help
Entry
CTT34_06235       CDS       T06424                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hmd  Halomonas meridiana
Brite
KEGG Orthology (KO) [BR:hmd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CTT34_06235
Enzymes [BR:hmd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CTT34_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like Glutaredoxin DAO Thi4 K_oxygenase FAD_oxidored FAD_binding_3 Methyltrn_RNA_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: QHD49314
LinkDB All DBs
Position
complement(1270517..1272073)
Genome map
AA seq 518 aa AA seqDB search
MLDANLKNQLKAYLEKVTQPFEIVASLDDGAKSRELLGLLEDISSLTDKITLHTDGQDSR
TPSFAINRPGEETGVVFAGIPMGHEFTSLVLALLQVGGHPPKTSQELLDQIKALDGEMLF
ETYYSLSCQNCPDVVQALNLMAIFNPKVRHVAIDGALFQDEVESREIMSVPSIYLNGKPF
DQGRMTLEQILAKVDTGAAEREAKKLSEKAAFDTLVIGGGPAGASAAIYSARKGINTGVA
AERFGGQVADTMGIENFISVTHTEGPKLVSALEEHVKEYDVDVMNLQRATSFKAAEAEGG
LHEVTFESGAKLKSKTLVLATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVLQKKLKSLPNVDIVLNAQTTEVTGDG
SRVNGLTYKDRNTDEVKSIELEGIFVQIGLVPNTEWLKGSPIEMSPRGEIIVDAHGMTSV
PGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatttaaaaaatcagttgaaagcttacctggaaaaagtgactcaaccg
ttcgagatcgttgcgtccctcgatgacggtgccaagtcacgtgaattgctgggtttgctg
gaagatatcagcagcctcaccgataagattactctgcacaccgacgggcaagacagccgt
accccgtcgtttgctatcaaccgccccggcgaagagaccggcgtggtatttgctggcatc
cccatgggccacgagttcacctcgctggtactggcgctgctgcaagtgggtggccaccca
cccaagacttctcaagaactgctcgatcagatcaaagccctcgacggcgagatgctgttc
gagacctactactcgctctcctgccagaactgcccggatgtcgtgcaagcgctgaacctg
atggcgatcttcaacccgaaggtgcgccacgtcgccatcgacggtgcgctgttccaggat
gaagtcgaatcgcgcgaaatcatgtccgtgcccagcatctacttgaacggcaagccgttc
gaccagggccgcatgaccctcgaacagattctggccaaagtagataccggcgctgccgaa
cgtgaagccaagaagctgagcgaaaaagccgcgtttgacaccctcgttatcggcggcggc
ccggcaggtgcgtcggcagcgatctactctgcccgtaagggcatcaataccggcgttgct
gccgaacgttttggcggccaagttgccgacaccatgggcatcgagaacttcatctccgtc
acccataccgaaggccccaagctggtcagcgcccttgaagaacacgtcaaagagtacgac
gtcgacgtgatgaacctccagcgcgccacgtcgttcaaagcggcggaagccgaaggcggc
ctgcacgaagtcactttcgagtccggtgccaagctgaaaagcaagaccctggtactggcg
accggtgctcgctggcgtgaaatgaacgtgcccggcgagcaggagtaccgcaacaaaggc
gttgcctactgccctcactgcgacggcccgctgttcaaaggcaagcgtgtggcggtcatt
ggtggcggtaactctggcgtcgaagccgcgatcgacctagccggtatcgtcggtcacgtg
accctggtggagttcatgggtgaaatgcgcgccgacgcggtactgcagaagaagctgaag
agcttgccgaacgtggatatcgtgctgaatgcccaaacgactgaagtcaccggtgacggc
agccgtgtcaacggcctgacctacaaagatcgcaacaccgatgaagtgaagagcatcgag
ctggaaggcatcttcgtacaaatcggcctggtacccaataccgagtggctgaaaggctca
cccatcgaaatgtcaccccgtggcgagatcatcgtcgatgcccacggcatgacctcggtg
cccggcgtgttcgccgccggcgatgttaccaccgtgccctacaagcagatcatcattgcc
atgggcgaaggtgccaaagcatcactgggagccttcgactatctgattcgtaattaa

DBGET integrated database retrieval system