KEGG   Haloferax mediterranei: HFX_1599Help
Entry
HFX_1599          CDS       T02129                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hme  Haloferax mediterranei
Pathway
hme00564  Glycerophospholipid metabolism
hme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HFX_1599 (glpA)
Enzymes [BR:hme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HFX_1599 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 3HCDH_N DAO_C FAD_oxidored Pyr_redox HI0933_like YbjQ_1 Pyr_redox_3 ApbA Lycopene_cycl GMC_oxred_N GIDA
Motif
Other DBs
NCBI-ProteinID: AFK19305
UniProt: I3R4Z5
LinkDB All DBs
Position
1517757..1519529
Genome map
AA seq 590 aa AA seqDB search
MNKSPSVLVIGGGSTGTGIARDLAMRGLDVTLVEKGNLTHGTTGRMHGLLHSGGRYAVSD
QASAKECIVENRVLRRIAGHCVEMTGGLFVQRPEDSDEYFQKKLEGCRECGIPAEVLSPE
EAREMEPYLAKDIKRAIKVPDGAVDPFRLCVANAASAVEHGARVETHSEVTDVLVEDGEV
VGVEVTHQTGTGPYVHGNPGEVEEIYADYVVNATGAWAGQIGDFAGVDVEVRPSKGVMTI
MNTRQVDTVVNRCRPKGDADIIVPHETTCILGTTDEEVEDPEDYPEEGWEVDLMIETLSE
LVPMLEDARTIRSFWGVRPLYEPPGTGTEDPTDITREFFLLDHADRDDLPGMTSIVGGKL
TTYRMMAEKISDHVCEKLDVEAECRTADVPLPGSEDFSVLRDYMDDFGLRSPIGRRSVQR
LGSRADDVLNSIDPNPVVCECEAVTRAEIQDALDTAGTDLNSVRIQTRASMGNCQGAICC
HRMANELAPEYDEAIVRSSLDDLYQERWKGERHAMWGEQLSQAALKHMLHATTMNRDEDP
ATAETDLDFAAFDDGSPSDGGNTSDSTSGGAVADGGRVAADDEGGANGDN
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcgccgagcgtcctcgtcattggcggggggtcgactggtacgggcatcgca
cgggacctcgcgatgcgcgggctggacgtgaccctcgtcgagaaggggaacctcacacat
gggacgacggggcggatgcacgggctcctccacagtggaggacggtacgcggtgtccgac
caggcatcggccaaggagtgtatcgtggaaaatcgcgtcctgcgacgaatcgcgggacac
tgcgtcgagatgacgggcgggctgttcgtccagcgccccgaagactccgacgagtacttc
cagaagaagttagagggctgccgcgagtgcggcatccccgccgaagtcctctcacccgaa
gaggcccgcgagatggagccgtacctcgcgaaggacatcaaacgcgccatcaaggtccct
gacggcgcagtcgacccgttccggctctgcgtggcgaacgccgcgagcgccgtcgaacac
ggcgcgcgcgtcgagacgcactcggaagtcacggacgtgctggtcgaagacggcgaagtc
gtcggcgtcgaagtgacccaccaaactgggaccggaccatacgttcacgggaaccccggc
gaagtcgaagagatatacgccgactacgtcgtcaacgcgaccggtgcatgggcaggtcag
attggcgatttcgccggcgtcgacgtcgaagtccggccatcgaagggtgtcatgaccatc
atgaacacccgacaggtcgacacggtcgtcaaccgctgccgaccgaagggtgacgcggac
atcatcgtaccccacgagacgacgtgtattctcgggacgacggacgaagaggtcgaagac
cccgaagactaccccgaagaaggctgggaagtcgacctgatgatagagacgctctcggaa
ctcgtgccgatgctggaagacgcgcggacgattcggtcgttctggggcgtccgcccgctg
tacgagccgccgggaacgggcacggaggacccgacggacatcacgcgcgagttcttcctt
ctcgaccacgccgaccgcgacgacctgccgggcatgacgagcatcgtcggcgggaaactc
acgacctaccggatgatggccgagaagatttccgaccacgtctgcgaaaaactcgacgtc
gaagccgagtgccgcaccgccgacgtgccgcttccgggcagcgaggacttctccgtcctt
cgtgactacatggacgacttcggcctgcgctcgccgattggccgtcgctcggtccagcga
ctcggctcgcgcgccgacgacgtgctcaacagcatcgacccgaacccggtcgtctgtgag
tgcgaggccgtcactcgcgccgagattcaggacgcactggacaccgcgggcacggacctc
aactccgtccgcattcagacgcgcgcctcgatgggcaactgtcagggtgcaatctgttgt
caccggatggcgaacgaactcgcccccgaatacgacgaagcaatcgtccgttcctcgctc
gacgacctctatcaggagcgctggaagggcgaacgccacgccatgtggggcgaacaactc
tcgcaggccgcgctcaagcacatgctccacgcgacgacgatgaaccgcgacgaagacccc
gcgacagccgagacggacctcgacttcgcggcgttcgacgacggcagtccctccgacgga
gggaacacgtcggattccacatccggcggcgctgtcgccgacggcggtcgtgtagctgcc
gacgacgaaggaggtgccaatggcgataactga

DBGET integrated database retrieval system