KEGG   Haloferax mediterranei: HFX_2725Help
Entry
HFX_2725          CDS       T02129                                 

Gene name
gph
Definition
(GenBank) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
hme  Haloferax mediterranei
Pathway
hme00630  Glyoxylate and dicarboxylate metabolism
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HFX_2725 (gph)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     HFX_2725 (gph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: AFK20403
UniProt: I3R843
LinkDB All DBs
Position
1935668..1936222
Genome map
AA seq 184 aa AA seqDB search
MALPDLSDFDAVVYDLDGTLVNLRVDWAAAAQDAALVLQDAGVEADSMDLWRMLDVADEA
GVRDELERELSAHERQGAWTSDRLPLADHLTADGVPSGVCSLNAEDACRVALDVHDLTHH
VDALVGRDTVATQKPAPEPLLETLGRMDVDPGAAVFIGDSARDKKTAERADIAFRYVDGG
PSGV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccccgacctctcggatttcgatgccgtcgtctacgacctcgacgggacgctc
gtgaacctccgcgtcgactgggctgcagccgctcaagacgccgcgctcgtcttgcaagac
gcgggcgtcgaagcggactcgatggacctctggcggatgctcgatgtcgccgacgaggcc
ggcgtccgcgacgaactagaacgagaactttcggcacacgagcgacagggagcgtggact
tccgaccggctcccgctcgccgaccaccttaccgccgacggcgttccgtcgggtgtctgt
tcgctcaacgccgaagacgcctgtcgcgtcgcactcgatgttcacgacctcacccaccac
gttgacgcactcgtcggtcgcgacactgtggcgacgcaaaaaccggcccccgagccactc
ctcgagacgctcggtcggatggacgttgaccccggcgccgcggtgttcatcggcgactcg
gctcgagacaagaagactgcggagcgcgccgatatcgcgttcagatacgtcgatggcggt
ccatcaggagtctga

DBGET integrated database retrieval system