KEGG   Haloferax mediterranei: HFX_5005Help
Entry
HFX_5005          CDS       T02129                                 

Gene name
speE
Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
hme  Haloferax mediterranei
Pathway
hme00270  Cysteine and methionine metabolism
hme00330  Arginine and proline metabolism
hme00410  beta-Alanine metabolism
hme00480  Glutathione metabolism
hme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HFX_5005 (speE)
   00330 Arginine and proline metabolism
    HFX_5005 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HFX_5005 (speE)
   00480 Glutathione metabolism
    HFX_5005 (speE)
Enzymes [BR:hme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     HFX_5005 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth DUF1616
Motif
Other DBs
NCBI-ProteinID: AFK20842
UniProt: I3R9D2
LinkDB All DBs
Position
pHM300:4663..6465
Genome map
AA seq 600 aa AA seqDB search
MSNSRTDTGTLLALTFVVSFCSFAYEFVYSELLTVMYGGTVTQYVITVGLYFFSLGIGAA
LSDDLDAADLGGNFFRTEVFLAAAAPAGFLLIVGLNSVRIPQSVPPELIWTVARLPVVVV
GFLSGFELPLLTHMVDELEDGETAMPVWIQNACNRVHNTVVKGLGTVWSVERTDGRRSGL
SVVLAMDYVGGLVGAVIYARVLYPGLGLIPTIFVLALLNGVAALVFVTYFGDWSRWPVTD
KWSWRSVNENSQSSTRALSVGHVSKTLLVVCLVLTASYAGVVAKHETADEQLSQLYLEQQ
TENKYPPGAMRANVVSQGTTTYQHVIRYNRTWTGTGPNPHFTGKTEQCLRLGSAIQLCES
WADSYHQGLVDVPMSLVEPGPETKVLVVGGGDWIAIDHLRKYNVTVDHVDLDGEFMQQTK
TDPFFRKWHDDAYEYDRLNTTTADGYRYLQESNETYDLVLLDIPGATDDDLLTLYSAEFY
SSIRNHLSDEGVVVTWGYSPDGYPQHHKAFINTVGAAGFTNQLSYWVREDIDSDGQSERI
EQFYVFAPGDRQSLTGDGETAYVRKHREQYRTIEWHAVPRYRGVRVNSIFHPNYDILIDT
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtccaactcacgaactgacaccggaacgctccttgcgctcacattcgtcgtttcattc
tgtagcttcgcctacgagttcgtctactccgaactcttgacagtgatgtacggcggaacc
gtgacgcagtacgtcatcacggttggcttgtatttcttcagcctcggtatcggcgcagcg
ctctccgacgacctcgatgccgcagacctcggcgggaacttcttccgaacggaggtgttt
ctcgccgccgccgcacccgcaggtttcctgctcatcgtcggtctcaatagcgtcagaatc
ccgcagtcggttccgcctgaactcatctggacagtcgcccgtcttcccgtcgtcgtcgtc
gggttcctctcgggattcgagctgccgcttttgactcacatggtcgacgaactcgaagac
ggggagacagcgatgccggtgtggattcaaaatgcctgcaaccgagttcacaataccgtc
gtcaagggtctcgggaccgtctggtccgtcgagcgaaccgatgggcggcggagtggacta
tcggtcgtgctggcgatggactacgtcggcggactcgtcggagctgtcatctacgctcgt
gtcctctatcccggtctcgggctcatcccgacgatattcgtgttggccctgctgaacggg
gttgccgcactcgtgtttgtcacctacttcggggattggtctcggtggccagtcactgat
aagtggtcttggcggtcagtcaatgagaactcgcagtcgtctacccgcgccctctctgtt
ggccacgtctcgaagacgctcctcgtcgtctgtctcgtgctaaccgcgtcatacgcgggc
gtggtcgcgaaacacgaaactgcggacgagcaactgtcgcaactctacttggaacaacag
accgagaacaagtatccaccgggtgcgatgcgtgcaaacgtcgtctcgcaggggacgacc
acgtaccagcacgttatccgatacaatcgcacctggaccgggaccggtccgaatccacac
ttcaccgggaagactgagcagtgtcttcgcttaggctcagcaatacaactgtgtgaaagc
tgggcggacagctatcatcagggtctcgtcgatgtacctatgtcgttggttgaacccggc
ccggagacgaaggttctcgtcgtcggtggcggggactggattgctatcgaccacctccgg
aagtacaacgtcaccgttgaccacgtcgaccttgatggagagttcatgcagcagacgaag
actgacccgttcttccggaagtggcacgacgacgcctacgaatacgaccggttgaacacg
acgacggcggacggatatcgatacctccaagagtcgaacgagacgtacgacctcgttctt
ctcgatatccccggagcgaccgacgacgacctgctcacgctctattcggcggagttctac
agttcgattcgaaaccacctctctgatgagggcgtcgtcgtgacgtggggctactctccc
gacgggtatccgcagcatcacaaagccttcatcaacacggtcggtgccgccggattcacg
aaccagctttcgtactgggttcgagaagacatcgattcggacgggcaatccgaacgcatc
gagcagttctacgtgttcgctccgggcgaccgccaatcactgaccggcgacggtgaaaca
gcctacgtccggaagcatcgcgagcagtaccgcactatcgagtggcacgcagtcccccgc
taccgcggtgtgcgagtgaattccatcttccatccgaactacgacatcctcatcgacacc
taa

DBGET integrated database retrieval system