KEGG   Haloferax mediterranei: HFX_6255Help
Entry
HFX_6255          CDS       T02129                                 

Gene name
adh10
Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hme  Haloferax mediterranei
Pathway
hme00051  Fructose and mannose metabolism
hme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HFX_6255 (adh10)
   00051 Fructose and mannose metabolism
    HFX_6255 (adh10)
Enzymes [BR:hme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     HFX_6255 (adh10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3 Methyltransf_25 TrkA_N 2-Hacid_dh_C Methyltransf_24 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AFK21378
UniProt: I3RAW8
LinkDB All DBs
Position
pHM500:277846..278880
Genome map
AA seq 344 aa AA seqDB search
MHVVELTEPRNFEHSKRPRPTPNSGEVLVQIRHVGICGSDVHYFEHGRIGDYVVESPLIL
GHESAGEVVEVGSGVDHLSPGDRVSLEPGIPCGECARCRAGTYNLCPDVVFMATPPDDGA
FAEFVSWDADFAYRLPEPVSTRAGALCEPLSVGIHATRRGEIGLGDTVLVTGAGPIGMMV
LKAARAAGASDVLVSDVVPSKLDRARNAGAATTVNVADEDLTDAVAAFTDGEGVDVVVEA
SGAAAAIASTTEVVRRGGTIVCIGLSQNDDIPIATNELVDKELDLRGSFRFRNTYHTAIS
LLEQGAIEVEDIIDFEMSMRDLTAAFERAQEPDVCKGMVELPSE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcgtcgaattaaccgaacccaggaacttcgagcacagcaaacgtccacggcct
accccaaattcgggcgaggtactcgtccaaatcagacacgtcggtatctgcggctcggac
gtacactacttcgagcacggccgtatcggcgactacgtcgtcgaatcaccgctcatctta
ggccacgagagcgccggcgaagtggtcgaagttggaagcggcgtcgaccatctcagcccc
ggcgaccgtgtttccctcgaacccggaatcccctgcggtgagtgcgcccgatgccgcgcg
gggacgtacaacctctgtcctgacgtggtgtttatggccacaccgccggacgacggtgca
ttcgcggagttcgtctcgtgggatgctgatttcgcttatcggctcccggaacctgtgtca
acgcgtgccggcgcactctgtgaaccactcagcgttggcatccatgcgacccggcgaggc
gaaatcggtctcggagatactgttctcgtcaccggtgctggtcctatcgggatgatggta
ctcaaagcggcccgcgcggctggtgccagcgatgtcctcgtttccgatgtcgtcccgtcg
aaactcgaccgcgcgcgaaacgcaggtgcagcaaccacggtaaacgtcgccgacgaagac
ctgacggacgcagtagcagcgttcactgacggcgaaggcgtcgatgtcgttgtcgaggca
tccggtgcagcggcggctatcgcctcgactaccgaggtggttcgacggggtgggacgatt
gtctgtatcggactctctcagaacgacgatatcccaatcgcgaccaacgaactcgtcgac
aaggaactcgacctccgtgggtcgttcagattcaggaacacgtaccacactgctatttcg
cttctcgaacagggagctatcgaggtcgaagatatcatcgacttcgagatgtcgatgcgt
gacctcaccgccgcgttcgaacgggcgcaagaacccgacgtgtgtaagggaatggtggaa
ctcccctctgagtga

DBGET integrated database retrieval system