KEGG   Hydra vulgaris: 100197618
Entry
100197618         CDS       T01080                                 

Definition
(RefSeq) uncharacterized LOC100197618
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hmg  Hydra vulgaris
Pathway
hmg04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100197618
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100197618
NCBI-ProteinID: XP_012558642
LinkDB
Position
Un
AA seq 263 aa
MESSRVYLFSRQDIAPSKATCRSLFGEVDHEQTKKELQLQYEKLLEQKSEHWNFNFKEQK
PGDNKDGLQWVPSDIDFSENTYTPGKSLIGALTQNTLSSASLESANSINVEPLAIEDCQI
IKTVMATQIRSCKYNDNTKLCGKKKKHQKTIDEFMKKKKFNSSLYLTLCKEHIASTYDIS
DCNKEVLSIELIIKKAKNIITSCSYHPPSSHIEEDTRLAPTADRLSVSVTSSEFENKAGL
LLGVVPIDIGEEIDMALGIMNLL
NT seq 792 nt   +upstreamnt  +downstreamnt
atggaaagttctcgagtttacttattttcacgtcaagatattgctccaagtaaagcgacg
tgtagaagtttgtttggagaagttgatcacgaacaaacaaagaaggaattgcaacttcaa
tatgaaaaactgctcgaacaaaaatccgaacactggaacttcaattttaaggaacaaaaa
cctggtgacaataaagacggtttgcaatgggttccttctgatatagatttttctgaaaat
acttacacaccaggaaaaagtttaattggtgcattaacgcaaaacacattgtcctcagca
agcttggaaagtgcgaatagtataaacgttgagcctttagctattgaggattgtcaaata
ataaaaaccgttatggcaactcagatacgttcgtgtaaatacaatgataacacaaaatta
tgtggaaagaaaaaaaaacatcaaaaaacaatcgatgaatttatgaaaaagaaaaagttt
aattcatctttatatctgacactttgtaaagaacatatagcatctacgtatgacatctct
gattgcaataaagaggttttatcaattgaactaataattaaaaaagctaaaaatataatt
acaagttgttcttatcacccaccttctagccatatagaggaggacactaggctggcccct
actgcagatagactatcggtatctgtaactagctcagagtttgaaaacaaagctggtctt
ttacttggtgttgtgccaattgatattggtgaggaaatcgatatggcattaggtattatg
aatctcctataa

DBGET integrated database retrieval system