KEGG   Hydra vulgaris: 100198749Help
Entry
100198749         CDS       T01080                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
hmg  Hydra vulgaris
Pathway
hmg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100198749
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hmg03036]
    100198749
Enzymes [BR:hmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100198749
Chromosome and associated proteins [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100198749
   HMT complexes
    COMPASS/SET1 complex
     100198749
    COMPASS/SET1 complex (yeast)
     100198749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET N-SET RRM_1
Motif
Other DBs
NCBI-GeneID: 100198749
NCBI-ProteinID: XP_002161122
UniProt: T2M378
LinkDB All DBs
Position
Un
AA seq 1403 aa AA seqDB search
MSSKHSWAYEKRSHKRSDGSSRGSERERDYKRDEFRKERDRRRSHHESRVKSDRYEDYNS
RYKVHDQPRRSLSQDGKKEMSSRNSLIESGFNNSPQSTPSPSTLPLGQVCANSYSPLVSN
SPQIESRTFDPRIVTKKVIEESKQNFRLLIDPAIKKGHMKVIRYNGVLPGQPPVIPKDPR
RHKSKVWTMEVCDLPLPDLKVDKNYVGPMPQNTIRFSGLNDNIDRKFLHELCESYGDIIE
YKVYFDPKTNRHTGTGKVIFDDKTDIKKVVDALNGRQVMGKVIKVWIEIKPPPGYAMWCQ
LEMECQKMRSTLTNSFSRHTSESSYQATPRTPNISSMHRNQPIASSSKSKHSKTVPSFYK
NCETPPPPPPLPKQNKSSSYNSPASNLLKYDDISPTENSKFSFKNGRHTPSVELIKNNCR
SQSPFMSPVTQNKNIVSKSYSPVSDPQTPQSPFKDLTPSEFYNNKLTDNYKPESVSTSKK
SSDDEDDDMSLSSISSNEDRKVELNVKNVKHSKLSRPLIHPHPLTQLHSLPPSHPLPQPC
LLTQPHPLTQGNVSLTGTIRPTHIYQYPPNNVQTQLNYYTLLAHPLQTRQQGPPPNGPQM
EFLVRQSSFVPLNSQPSFSPYQNPQIVRTALIPIVPSNHNIPIQHHQISLTPDHIQNVLS
VADSTANIHSTGSVSENIVPPANIPYTSDELLLAFQVKTGCARDLSIELKSILLKDTLKK
LVEQSAFSAFENWWSKQVLNHNKNTEVLSETSSTTTRSLSEEKQNALLNQQETTKEPSTI
SALLQTLFGFDKNNDNRPPSSNFLSSFRITRKPHLQPTSLKSSQATRKRSSWSSIHGSHV
KQRRLEESEDEPMDTVSDDEGEDEEKIDDEFEQLALRQRQVCRSGSSLYQKIYSDDSEDE
SDAESKSENEDMDEKMSSDSSSKSSTEESSSEFSESSEEEYTEAELTENKKVLVESKEKN
IRKNQKSSTAKKDIELDSKVMFRSMYDEPRRRNANKYMDQKARNKSIILSKPEKESSASS
TDTGDESSHENNKEFNTISDILIKETEIQTENLLKKLIWLEHNYFTIPPSLSSPPSSPLP
QPKSSTTNRRSFMNKALSENEHKKFTMRSSKDEKLLIWDILKQGIDAEDLLYLKEAFESL
QQVDAFEVKNLRWCEHPITITSPQKYKRNESKLRIHKSGCARTEGFYKIPIVEKAQYLKS
ALRQLNAKHQSDIQMQQISDQAGTEHKIKSRQKRAVQRRLASSIAQEEFSSLINYNNKLM
RRKKALRFSKSSIHNWGLFACEPINADEMVCEYVGQMVRSIVAEIRERRYEKQGIGSSYL
FRLDSDSVIDATKDGCNARFINHCCDPNCYAKVILVEGAKKIVIYSRRAIKLGEEITYDY
KFPIEDEKIPCLCGAALCRGTLN
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaaacacagttgggcgtatgaaaagcgtagtcacaaaagatcagatggttca
agtagaggatcagaaagagaaagagattacaaaagagatgaatttagaaaagaaagagat
cgtaggaggagtcatcatgaaagtcgtgtaaaaagtgaccgatatgaagattataatagc
cgttacaaagttcatgatcagccaagaagaagtttatcacaagatggaaaaaaagaaatg
tctagcagaaatagtttaattgaatctggatttaacaattcacctcagtcaacgccctca
cctagtacattacctttaggtcaagtttgtgctaatagctattctccattggtttctaat
tcaccacagatagaatccagaacttttgaccctcgtattgttacaaaaaaagttattgaa
gaaagcaagcaaaattttcgacttcttattgatccagcaataaagaaaggtcacatgaaa
gttattcgatataatggagttctacctgggcaacctcctgtaataccaaaagatcctcgt
cgtcacaaaagtaaagtctggacaatggaagtttgtgatctacctctgccagacttaaag
gttgataaaaactatgttggaccaatgcctcaaaatactattcggttttctggattaaat
gacaatattgatcgtaaatttttacatgaactctgtgaatcttatggagatattattgaa
tacaaagtttattttgatccaaaaactaatcgtcatactggtacaggaaaagttatcttt
gatgataaaactgatatcaaaaaagttgttgatgctttaaatgggcgacaggttatggga
aaagttattaaagtttggattgaaataaaacctcctcctggttatgcaatgtggtgtcag
ttggagatggaatgtcaaaagatgcgttccacattaaccaatagtttttcaagacatact
tcagaatcatcttatcaagctactcctagaaccccaaacataagttcaatgcacagaaat
caacctattgctagctcctcaaaaagcaaacattcaaaaactgttcctagcttttataaa
aattgtgaaactccgcctcctccaccacctctaccaaaacaaaacaaaagttcttcgtat
aattcacctgcttctaatcttttaaaatacgatgatatatctccaacagaaaattcaaaa
ttcagttttaaaaatgggaggcatactcctagcgtagaattaataaaaaataattgtaga
tctcagtctccttttatgagcccagtgactcagaataaaaatattgtctcaaaatcttat
agtcctgtgtctgaccctcaaacacctcaaagtccttttaaagatctgacaccatcagag
ttttacaataataaacttactgataattacaagcctgaatctgtatcaacttccaaaaaa
agtagcgatgatgaagatgatgatatgtctttatcttcaattagttcaaatgaagataga
aaagtcgaattgaatgttaaaaatgttaaacattcaaagttatcacgtccattaatacat
cctcatccgctaacgcaacttcattcattaccgccctctcatccgctaccgcaaccttgt
ctgctaacacaacctcatcctttaacgcaaggaaatgttagtttaactggaacaattaga
cccactcatatctaccagtatccaccaaataatgttcaaactcaacttaattattatact
ttactagctcatcctttacagactagacaacaaggacctccgcccaatggacctcaaatg
gaatttttagttcgacagtcttcttttgttcctttaaatagtcaaccttcattttcacct
tatcaaaaccctcaaatagtgcgaactgctttgatacctattgttccctcgaatcataat
attccaatacagcatcatcaaatttcattgactccagatcatatacaaaatgttttatct
gttgctgattctacagctaacatacatagtactggttcagtgagtgaaaatatagtacca
cccgctaacattccatatacttctgatgaactattattagctttccaggtgaaaactggt
tgtgctcgagatcttagtattgagttgaaaagtatacttcttaaagatacattaaaaaaa
cttgttgagcaatcagcatttagtgcttttgagaattggtggagtaaacaagttttgaat
cacaacaaaaacactgaggtattatctgaaacttcaagcaccactacaagatcattgtct
gaagaaaagcaaaatgctttgttaaatcagcaagaaactacaaaagaaccaagcacaata
tctgctttgcttcaaactctttttggttttgataaaaataatgataatagaccaccatct
tctaattttttaagttcatttagaattacacgaaaaccacacttacagccaacttcatta
aaatcttctcaagcaacacgtaaaagatcatcatggtcatcaattcatggttcccatgtc
aaacaacgacgattggaagagagtgaagatgagccaatggatactgtttcagatgatgaa
ggtgaagatgaagaaaaaattgacgatgaatttgagcaacttgcgttgagacaaagacaa
gtatgtagaagtggttcatcattgtaccagaagatttattcagatgacagtgaagatgaa
agtgatgctgagtctaaaagtgaaaatgaagatatggatgaaaaaatgtcatcagattca
tcatctaaatcctctactgaagagtcttcttcagaattttctgaatcttcagaagaagaa
tatactgaagctgaactaacggaaaacaaaaaggttcttgttgaaagtaaagaaaaaaac
attagaaaaaatcaaaaatcatctactgcaaagaaagacattgaattagatagtaaagtc
atgtttagaagtatgtatgatgagccacgtagaagaaatgctaacaaatatatggatcaa
aaagcaagaaacaaatctatcattctgtctaaacctgaaaaggaatcgtctgcttcaagt
acagatacaggagatgagtcatctcatgaaaataacaaagagtttaatacaatttctgac
attttgataaaagaaacagaaattcaaaccgaaaatttattgaaaaagttaatatggtta
gaacacaactacttcactataccaccttcactgtcatcaccaccatcatcaccattacct
caaccaaagtcatctaccacaaaccgaagaagttttatgaataaagctttgtcagaaaat
gaacacaaaaagtttactatgagatctagcaaagatgaaaaactactcatatgggatatt
ttaaaacaaggaattgatgcagaagatttattataccttaaagaagcatttgaaagttta
caacaggttgatgcatttgaagtaaaaaacttacgttggtgtgaacatcctattactata
acatctcctcaaaagtataaaagaaatgaatctaaattacgcatccacaaaagtggttgc
gcccgcaccgaaggcttttataaaatacctatagtagaaaaggctcaatacctgaaaagt
gctctaagacagttgaatgctaaacatcaaagtgatattcaaatgcaacagatttctgat
caagctggtaccgaacataaaataaaatcaagacaaaagcgtgcagtgcagagaagatta
gcttcttcgattgctcaagaagaatttagcagtcttattaactacaataacaaacttatg
agacgcaaaaaagcattgcgcttttcaaagtccagtatacataactggggattatttgca
tgtgaaccaattaatgcagatgagatggtatgcgaatatgtaggtcaaatggtacgctcg
attgttgctgaaatacgagaacgaaggtatgagaaacagggcattggtagcagttacttg
tttcgattggactctgatagcgttatcgacgccacaaaagatggttgtaatgctcggttt
ataaaccactgctgtgatcctaattgttatgctaaagttatattggtagaaggtgctaaa
aagattgttatatattccagacgagccatcaaactaggagaagaaataacgtatgactat
aagttccctattgaagatgaaaaaattccgtgtttatgtggagctgctctttgtagaggg
acgcttaattag

DBGET integrated database retrieval system