KEGG   Hydra vulgaris: 100200684Help
Entry
100200684         CDS       T01080                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100200684
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100200684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 100200684
NCBI-ProteinID: NP_001274724
UniProt: I3V7W8
LinkDB All DBs
Structure
PDB: 

Position
Un
AA seq 152 aa AA seqDB search
MAKSAICVLEGIVKGTIKFEDIGDGKTHVSGKITGLQPPGKHGFHIHQFGDYSGGCMSTG
PHFNPFNKEHGGPEDENRHAGDLGNIVSDDYGNADVNIEDSQIPLDGPNSIIGRALVVHQ
NEDDLGLGGHKDSKTTGNAGARLSCGVIGLAK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatctgctatttgtgtgttagaaggtatagttaaagggacaataaagtttgaa
gatataggtgatggaaaaactcatgtgagtggaaaaattacaggtctacaacctcctgga
aaacatggttttcatattcatcagtttggggattattcaggtggttgtatgagtactggt
cctcattttaatccatttaacaaagaacacggtggaccagaagatgagaatcgacatgca
ggtgatctaggtaacattgtctcagatgattatggaaatgctgatgttaatatagaagat
tcccaaattcctttggatggtccaaacagcatcattggtagagctttagtagtccatcag
aatgaagatgatttaggattaggaggccataaagatagcaaaaccaccggaaatgctgga
gcaagattgtcatgtggtgtaattggacttgcaaaataa

DBGET integrated database retrieval system