KEGG   Hydra vulgaris: 100200906Help
Entry
100200906         CDS       T01080                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hmg  Hydra vulgaris
Pathway
hmg04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100200906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmg01001]
    100200906
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100200906
Protein kinases [BR:hmg01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100200906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 100200906
NCBI-ProteinID: XP_002170610
LinkDB All DBs
Position
Un
AA seq 506 aa AA seqDB search
MAATESPKFFDIYELKEELGKGAFSIVKRCIHKENRMEFAAKIFNTKKLSTRDLQKLERE
AKICRMLKHPNIVRLHASIPEDGVHYLVFDLVTGGELFEDIVAREYYSESDASHVIQQIL
ESVLHCHQNNIVHRDLKPENLLLASKEKGAAVKLADFGLAVECDNKNVWHGFAGTPGYLS
PEVLRREPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAAAYDYPSPEWDTVT
KEAKELIDSMLTLDVKKRVTAAEALKHPWISDRHACASTFHRQETINGLKRFNARRKLKG
AFLTSLIVSAGAKVLSTTGNESKVISTPIRSGTVIEKKAVKIAEVVDEAKEKALADKQRK
ASDDEVIIDDDDQRISKEQEIVKLTQKLISSITMGDYETYSKLCDDKMTCFEPLCKGNLV
EGLDFHKFYFENLKNAASSVNTTILAPHVILLSDESACISYIRLTQKIDSNQQPLTEQTE
ESRIWQRKGSRWVCVHVHISRNGSVR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaactgaaagtcccaagttttttgacatatatgaattaaaagaagaacttgga
aaaggtgcttttagcattgttaaaagatgcattcacaaagaaaatcgtatggagtttgca
gcaaaaattttcaatacaaagaaactatcaactagagatttacaaaaacttgaaagagaa
gctaaaatttgtcggatgttaaaacatcctaatattgttcgccttcatgcaagtattcca
gaagatggtgttcattatcttgtctttgatctagttactggtggtgagctttttgaagac
attgttgccagagaatactatagcgaatcagatgcaagtcatgtaattcaacaaatccta
gagagtgttttacattgccatcaaaataatatagtgcatcgagatctcaagcctgaaaat
ttattgcttgcaagtaaagaaaaaggtgctgctgttaaactagctgattttggactagct
gttgaatgtgacaataaaaatgtttggcatggtttcgctggtacacctggatatctttct
cctgaagttcttagaagggaaccttatggaaagcctgttgatatatgggcgtgtggtgtc
attctttatattctattggttggttatcctcccttctgggatgaagatcaacatcgcctt
tatgcacaaataaaagctgcagcttatgattatccatctcctgagtgggatacagttact
aaggaggcaaaggaacttatagattcaatgctgacattagatgttaaaaaacgagttact
gcagctgaggcattaaaacatccatggatttcagacagacacgcctgtgcatcaacgttc
cacagacaagaaactattaacggattgaagcgtttcaatgctcgtagaaaactgaagggt
gcttttcttaccagcttaattgtatcagctggcgcaaaagtgctaagtactacgggtaat
gaatcgaaagtgatatcaacaccaataagaagtggcactgtcattgaaaaaaaagctgtg
aaaattgccgaagttgtggatgaagccaaagaaaaagctcttgctgataaacaaagaaag
gcatctgatgatgaagttataattgatgatgatgaccaaagaatttccaaagaacaagaa
attgttaagcttacacaaaaattaattagtagcattacaatgggagactatgaaacatat
tctaaactttgtgatgacaaaatgacgtgttttgaacctctttgcaaaggaaatttggtt
gaaggtctagactttcacaaattttactttgaaaacttaaagaatgctgcctcttctgtg
aatactaccattcttgctccacatgtcatacttctttcagatgagtctgcttgtattagt
tatattcgactgacacaaaagattgatagtaaccaacaaccgttaacagagcagacggaa
gagagcaggatttggcaacgaaaaggaagtcgttgggtatgtgttcatgtgcatattagt
cgaaacggttctgttaggtaa

DBGET integrated database retrieval system