KEGG   Hydra vulgaris: 100201878Help
Entry
100201878         CDS       T01080                                 

Definition
(RefSeq) serine/threonine-protein kinase A-Raf-like
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg04068  FoxO signaling pathway
hmg04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100201878
   04150 mTOR signaling pathway
    100201878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hmg01001]
    100201878
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100201878
Protein kinases [BR:hmg01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100201878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 APH Pkinase_fungal TUG-UBL1 Kdo LRRFIP DUF1258 Prok-RING_1
Motif
Other DBs
NCBI-GeneID: 100201878
NCBI-ProteinID: XP_002156903
UniProt: T2MGW2
LinkDB All DBs
Position
Un
AA seq 775 aa AA seqDB search
MLKMAATSESDLLGNKYFPRDPDSPSQLSRDQRSMTISNINSVGIMHKFKSNEIRNSQIS
NEVQNVKQVFKLTEDRLKELEVLFQSGFSHPPSILFEEVEELKGKLDALRKRENTLLHQK
PELLQNGFKHTITHESSDESSPISSPSPSQSNAVSHESEKVVSNGNVAPSSPLHAHFRAY
LPNNQRTMIKYKPGQTVHEALLKAMTLRGLNTESYVVYRKSNRQHVDWDADVSSLDRAEV
LVEAFNKEENIRSICHNFVRKTFFTLTFCDACGKLLFQGFRCQTCGYRFHQKCAKEVPSL
CQQTVHYNGYKRNSNQNSVISPIPLTPRLLGPQDRGRSLSVPNVNTIDQSATIGINEELA
ENFHRNDSVTSAGIMHPFLNHFIINQRRIPDLISRETGNNNIFNFSTVLPQLTSNQPHAQ
ELSGIPGSLLNPARIRHRSKSHSDEKQKFKTVSHRDSNDDWEIKEGEIQVGQRIGSGSYG
TVYKGYWHGTVAVKQLNVKHPNPQQLQAFKNEVAVLRKTRHVNILLFMGCMSAPNLSIVT
QWCEGSSLYRHLHVMDIKFSLPQLIEIARQTAQGIDYLHAKSIIHRDLKSNNIFLQEDYT
VKVGDFGLATVKTRWSGDHGCEQPSGSILWMAPEVIRMQDPNPYTFMSDVYAFGICIYEL
ITCTLPYSNIGNKDQLIYMVGRGYLKPDLSKIRSDCPKALKRLCIECCTFNRDERPLFLQ
ICRSIESILKTLPKINRSTSEPLLHRAKLNSDMEMLYPCPTPRTPMQDPMVFNYS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagatggcggccacttcggaaagtgatttactggggaataaatattttccaagg
gacccggatagcccctcacaattaagtcgtgaccagagatctatgacaatatcaaacata
aactcagttggaattatgcacaaatttaaaagtaatgaaatacgaaattcacaaatttcc
aacgaagtacaaaatgttaagcaagtctttaaattgactgaggatagattaaaagagctt
gaagtattgtttcaatcaggtttctctcatcctccgtctatactttttgaggaagttgaa
gaacttaaaggtaaacttgatgctttacgaaaacgagaaaatacactgttacatcaaaaa
ccagagttacttcaaaatggtttcaaacacacaattacacatgaatcctcagatgaaagt
agccctatatcttctccatctcccagccaaagtaatgcagtatcccatgaatcagaaaaa
gtcgtttcaaacggaaatgttgcaccatcttcaccactccacgctcattttcgtgcatac
ctgcctaacaatcaacgaactatgatcaaatataaaccaggacaaactgtacatgaagct
cttttaaaagctatgactttaagaggattgaacacagaatcttatgtggtttatcgaaaa
tcaaacagacaacatgttgattgggatgctgatgtttcttctttagatagagctgaggta
ttagtggaggcttttaataaagaagaaaatatcagaagcatatgccataactttgtcagg
aaaacattttttacactaacattttgtgatgcgtgtggaaaattactgtttcaaggtttt
agatgtcaaacttgtggttacagatttcatcaaaagtgtgcaaaagaagtaccttcatta
tgtcaacaaacagttcattataacggttataaaaggaatagcaaccaaaactccgtaatt
tctcctatacctttgacaccacgactacttggacctcaagaccgtggccgctccctctca
gtacctaatgttaatacgattgatcaatctgcaacaattggtattaatgaagaattggct
gaaaactttcatcgaaatgactctgtgacatcagctggtattatgcatccgtttttaaat
cattttatcataaatcaacgacgtatcccggatttaatctctcgtgaaactgggaataac
aatatttttaatttttcaacggttcttcctcagttaaccagtaaccagccacatgctcaa
gagttaagtggtattcctggttcccttttaaatcctgcaagaattcgtcatcgatctaaa
tcacattcagatgaaaagcaaaagttcaaaactgtcagtcatcgcgattctaatgatgat
tgggagattaaggaaggtgaaattcaagtgggacaaagaattggttctggatcttacgga
actgtgtacaaaggatattggcatggaacagttgctgtaaaacagttaaatgtgaaacac
cccaacccacaacagttgcaagcatttaaaaatgaagttgctgtattgcgcaaaacacgg
catgtgaacattttattatttatgggatgtatgtctgcaccaaatttatctatagttacc
caatggtgtgaaggctctagtttatatagacatttacatgttatggacataaaattttct
ttaccacaacttatagaaattgctagacagacagctcaaggaattgattatttgcatgca
aaatcgataatacatcgtgatttgaaatcaaataatatttttttgcaagaagattacact
gttaaagttggagattttggtcttgctacagttaaaacaaggtggagtggagatcatggt
tgtgagcaaccatcagggtctattttatggatggctcctgaggttattcgcatgcaagat
ccgaacccatacacatttatgtctgatgtttatgcatttggaatatgcatttatgaactt
ataacttgtacactgccttactcaaatattggtaataaagatcagttgatatatatggta
ggtcgtggttatttgaaaccagatttatctaaaattcgctcagactgtccgaaagcatta
aaacgactatgcatagaatgttgtacctttaatagagatgaacgaccattgtttttacaa
atttgtcgatctattgaatcaattcttaaaacgttacccaaaattaatcgcagtacatca
gaaccactgttgcacagggctaagcttaattctgacatggaaatgttatacccttgcccc
acaccaagaactccaatgcaagatccaatggtctttaattatagctag

DBGET integrated database retrieval system